KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r) (serotype O 9): YE105_C3391Help
Entry
YE105_C3391       CDS       T01480                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r) (serotype:O:9)
Pathway
yep00250  Alanine, aspartate and glutamate metabolism
yep00410  beta-Alanine metabolism
yep00430  Taurine and hypotaurine metabolism
yep00650  Butanoate metabolism
yep01100  Metabolic pathways
yep01110  Biosynthesis of secondary metabolites
yep01120  Microbial metabolism in diverse environments
yep02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:yep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    YE105_C3391
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    YE105_C3391
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    YE105_C3391
   00430 Taurine and hypotaurine metabolism
    YE105_C3391
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    YE105_C3391
Enzymes [BR:yep01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     YE105_C3391
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC CDC37_M
Motif
Other DBs
NCBI-ProteinID: ADZ43885
LinkDB All DBs
Position
complement(3909568..3910968)
Genome map
AA seq 466 aa AA seqDB search
MTRKSLDDYRSTLLDSRFGSQAIRNISENKEFPKEEMREDIAFQIISDELFLDGNARQNL
ATFCQTWDDDNVHKLMDLSINKNWIDKEEYPQSAAIDLRCVNMMADLWNAPTPKGGQGVG
TNTIGSSEACMLGGMAMKWRWRKKMEVAGKPTNKPNFVCGPVQICWHKFARYWDVEIREI
PMIPGQLFMDPKRMIEACDENTIGVVPTFGVTYTGNYELPKPLHEALDKLQKDTGLDIDM
HIDAASGGFLAPFVAPDIEWDFRLPRVKSISTSGHKFGLAPLGCGWVIWRDAAALPEELI
FNVDYLGGQIGTFAINFSRPAGQVISQYYEFIRLGREGYTKVQSACYQVAEFLAKEIAPL
GPYEFYFNGNPNEGIPAICFRIKEGAKPGYTLYDLSERLRLRGWQVPAFTLCGKMSDVVV
MRIMCRRGFEMDFAELLLDDYKASLKYLSEHPSLGGEASQNSFSHT
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgactagaaaatctctggatgattatcgctctacgttattagattctcgctttggttct
caagcgattcgcaatatctcggaaaataaagagtttcctaaagaggaaatgcgcgaggat
attgcttttcaaatcataagtgacgagctatttcttgatggtaatgcacgacaaaacctc
gcgacattttgccaaacgtgggacgacgataatgtccacaaactgatggatctttcgata
aataaaaactggattgataaagaggaatatccgcaatcggcggcaatagacttgcgttgt
gtaaatatgatggccgatttgtggaatgcccctacgccaaaaggcgggcaaggggtgggg
acaaataccattggttcttcagaggcttgcatgctcggcggcatggcgatgaagtggcgc
tggcgcaaaaaaatggaagtggcaggcaaacccacgaataaacctaattttgtttgtggg
ccggtacaaatttgctggcataaatttgctcgttattgggatgtcgaaatacgtgaaatt
cctatgatcccagggcaattatttatggacccaaaacggatgatagaggcgtgtgacgaa
aatactattggtgtggttccgactttcggcgtgacttacaccggcaattatgaattaccc
aaacctttacatgaggcactggataaactccagaaggataccggcctcgatattgatatg
catattgatgcggcgagtggcggatttttagcgccttttgttgcccctgatattgaatgg
gatttccgtttaccaagagtgaaatcaatcagcacttccgggcataaattcgggttagcg
cctttgggatgtggttgggttatttggcgtgatgccgccgctttacctgaagagctgata
tttaatgttgattatctcggcggccagatcggtacttttgcgattaacttctcgcgcccg
gcaggacaagttatttcccaatattacgaattcatacgattagggcgtgaaggctatacc
aaggtgcaaagtgcctgttatcaagtggcagaattcctagccaaagaaattgcaccactc
gggccttatgaattctatttcaatggcaacccaaatgagggcattcccgcgatttgtttc
cgcatcaaagaaggggccaagccgggatataccctatatgacctttccgagcgtttgaga
ctgcgtggttggcaagttccggcatttactttgtgcgggaagatgtctgatgtcgtagtt
atgcgcatcatgtgccgccgcggattcgagatggatttcgccgagctgttattagacgat
tataaagcttctctgaaatatctaagtgagcatccatcccttgggggcgaagcaagtcag
aatagttttagccatacataa

DBGET integrated database retrieval system