KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r) (serotype O 9): YE105_C3598
Entry
YE105_C3598       CDS       T01480                                 

Definition
(GenBank) homoserine O-succinyltransferase
  KO
K00651  homoserine O-succinyltransferase/O-acetyltransferase [EC:2.3.1.46 2.3.1.31]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r) (serotype:O:9)
Pathway
yep00270  Cysteine and methionine metabolism
yep00920  Sulfur metabolism
yep01100  Metabolic pathways
yep01110  Biosynthesis of secondary metabolites
yep01230  Biosynthesis of amino acids
Module
yep_M00017  Methionine biosynthesis, apartate => homoserine => methionine
Brite
KEGG Orthology (KO) [BR:yep00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    YE105_C3598
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    YE105_C3598
Enzymes [BR:yep01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     YE105_C3598
    2.3.1.46  homoserine O-succinyltransferase
     YE105_C3598
SSDB
Motif
Pfam: HTS
Other DBs
NCBI-ProteinID: ADZ44092
LinkDB
Position
complement(4152358..4153287)
AA seq 309 aa
MPIRVPDELPAVSFLRNENVFVMTSSRAKTQEIRPLKVLVLNLMPKKIETENQFLRLLSN
SPLQIDIQLLRIDSRESKNTPAEHLNNFYCDFEDIQEQNFDGLIVTGAPLGLVDFCDVAY
WPQIERIIAWAKDHVTSTLFVCWAVQAALNILYGIPKMTRETKLSGIYQHQTDKPLALLT
RGFDETFLAPHSRYADFPVELLQQYTDLDILVSSEEAGAYLFASKDKRVAFVTGHPEYDV
DTLAGEYQRDLAAGLNPQIPLNYFPNDDASLPPKASWRSHGHLLFANWLNYYVYQITPFD
LRHMNPTFD
NT seq 930 nt   +upstreamnt  +downstreamnt
atgccaattcgggttcctgatgaattaccagcagtgagttttttacgtaatgagaatgtg
tttgtcatgacctcatcgcgtgcaaaaactcaggaaattcgtcccctgaaggtattggtt
ttaaatctgatgcctaaaaaaattgagacggaaaatcaattcctgcgtttactctccaac
tcacccctacagatcgatattcaattgttgcgaattgatagtcgcgaatcaaaaaatacg
ccagctgagcacctgaacaacttttattgtgattttgaagatattcaggagcaaaatttt
gacgggttgattgtgacaggggctcctctgggcttggtcgatttctgtgatgttgcttat
tggccgcaaattgagcgtattattgcctgggcaaaagatcatgtaacctcaactttattc
gtgtgttgggcggtacaggcagccttaaatatcttatacggtattcctaaaatgacgcgt
gagactaagctctcaggcatttaccagcatcaaacagataaaccactggcactactcacg
cgtggtttcgatgaaacattcctggccccacactctcgttatgccgatttccccgttgag
ctacttcagcaatacactgatctggatattctggtttcctcggaagaggccggtgcatat
ttgtttgccagtaaagacaagcgagtcgctttcgtcaccggtcatcctgaatatgatgtc
gataccttagcgggagaatatcaacgtgatctggctgccggtctgaatccacaaatccca
ctcaattatttccccaatgatgatgcttcattacccccaaaagcatcctggcgtagccac
ggacatctgttgtttgctaactggttgaactactacgtttaccaaatcacaccatttgat
ttacgtcatatgaatcctactttcgactaa

DBGET integrated database retrieval system