KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r) (serotype O 9): YE105_P0007Help
Entry
YE105_P0007       CDS       T01480                                 

Definition
(GenBank) yop type III secretion system effector protein
  KO
K23478  outer membrane protein YopM
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r) (serotype:O:9)
Pathway
yep05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:yep00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    YE105_P0007
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LRR_4 TTSSLRR LRR_8 LRR_9
Motif
Other DBs
NCBI-ProteinID: ADZ44440
LinkDB All DBs
Position
105.5R(r)p:5916..7082
Genome map
AA seq 388 aa AA seqDB search
MYGFICNEKTDNKDIFRKAFNMFINPRNVSNTFLQEPLRHSSDLTEMPVEAENVKSKAEY
YNAWSEWERNAPPGNGEQRGMAVSRLRDCLDRQAHELELNNLGLSSLPELPPHLESLVAS
CNSLTELPELPQSLKSLQVDNNNLKALSDLPPLLEYLGAANNQLEELPELQNSSFLTSID
VDNNSLKTLPDLPPSLEFLAAGNNQLEELSELQNLPFLTAIYADNNSLKTLPDLPPSLKT
LNVRENYLTDLPELPQSLTFLDVSDNIFSGLSELPPNLYNLNASSNEIRSLCDLPPSLVE
LDVRDNQLIELPALPPRLERLIASFNHLAEVPELPQNLKLLHVEYNALREFPDIPESVED
LRMDSERVIDPYEFAHETIDKLEDDVFE
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgtatggtttcatttgcaatgaaaaaaccgataataaagatattttcagaaaggcattc
aatatgtttataaacccaagaaatgtatctaatacttttttgcaagaaccattacgtcat
tcttctgatttaactgagatgccagttgaggcagaaaatgttaaatctaaggctgaatat
tataatgcatggtcggaatgggaacgaaatgcccctccggggaatggtgaacagagggga
atggcggtttcaaggttacgcgattgcctggaccgacaagcccatgagctagaactaaat
aatctggggctgagttctttgccggaattacctccgcatttagagagtttagtggcgtca
tgtaattctcttacagaattaccggaattgccgcagagcctgaaatcacttcaagttgat
aataacaatctgaaggcattatccgatttacctcctttactggaatatttaggtgccgct
aataatcagctggaagaattaccagagttgcaaaactcgtccttcttgacatctattgat
gttgataacaattcactgaaaacattacctgatttacctccttcactggaatttcttgct
gctggtaataatcagctggaagaattgtcagagttgcaaaacttgcccttcttgactgcg
atttatgctgataacaattcactgaaaacattacccgatttacccccttccctgaaaaca
cttaatgtcagagaaaattatttaactgatctgccagaattaccgcagagtttaaccttc
ttagatgtttctgataatattttttctggattatcggaattgccaccaaacttgtataat
ctcaatgcatccagcaatgaaataagatctttatgcgatttacccccttcactggtagaa
cttgatgtcagagataatcagttgatcgaactgccagcgttacctccacgcttagaacgt
ttaatcgcttcatttaatcatcttgctgaagtacctgaattgccgcaaaacctgaaactg
ctccacgtagagtacaacgctctgagagagtttcccgatatacctgagtcagtggaagat
cttcggatggactctgaacgtgtaattgatccatatgaatttgctcatgagactatagac
aaacttgaagatgatgtatttgagtag

DBGET integrated database retrieval system