KEGG   Yersinia enterocolitica 2516-87: CH48_1429Help
Entry
CH48_1429         CDS       T03644                                 

Gene name
hslO
Definition
(GenBank) 33 kDa chaperonin
  KO
K04083  molecular chaperone Hsp33
Organism
yet  Yersinia enterocolitica 2516-87
Brite
KEGG Orthology (KO) [BR:yet00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:yet03110]
    CH48_1429 (hslO)
Chaperones and folding catalysts [BR:yet03110]
 Heat shock proteins
  HSP33
   CH48_1429 (hslO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33
Motif
Other DBs
NCBI-ProteinID: AJJ27122
UniProt: A0A0E1NI47
LinkDB All DBs
Position
1568826..1569740
Genome map
AA seq 304 aa AA seqDB search
MSNHDQANHDQSNHDQLQRYLFANHAVRGELVSVNETYQQVLANHDYPPAVQKLLGEMLV
ATSLLTATLKFDGDITVQLQGGEGPLSLAVINGNNQQEMRGVARFKGEISDESTLKEMMG
NSGYLVITITPAQGERYQGVVALEGETIAACLENYFMQSEQLPTRLFIRTGDVEGKPAAG
GMLLQVLPAQERNEDEFDHLAQLTTTIKAEELFTLPANEVLYRLYHQEEVTLYEPQNVSF
RCTCSRERCADALVTLSEDDVKEMLEQDGNIDMNCEYCGTHYLFDAVDIATLKSGNSPSS
EQIH
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgtctaatcacgatcaagctaatcacgatcaatctaatcatgatcaactgcagcgctac
ctgttcgctaaccatgctgtgcgcggtgaactggtttcagtcaatgaaacctaccaacag
gtgctcgctaatcatgactaccctccagcggtacaaaaactgttgggtgaaatgttggtc
gcgaccagtctgctgaccgcgaccctcaaatttgacggtgatatcacggtgcaattgcaa
ggtggggaaggcccactctcactggcagtgattaacggcaataaccagcaagaaatgcgt
ggtgtcgcccgctttaaaggtgaaatcagtgatgaaagcacgctgaaagagatgatgggc
aacagtggctatctggtcataaccatcacgcctgcacagggtgagcgctatcaaggcgta
gtggcattggaaggtgagactatcgccgcctgcctggaaaattactttatgcagtcagaa
cagctacctacccgcctgtttatccgcaccggtgatgtggaaggtaaacctgccgcaggc
ggtatgttgttgcaagttctacccgcacaggagcgtaatgaagatgaatttgatcatctc
gcacagctcactaccaccatcaaagccgaggagctgttcaccctgccggccaatgaggtg
ctgtatcgtttatatcatcaggaagaagtgacactttacgaaccacaaaatgtcagtttc
cgctgtacctgttctcgcgaacgttgcgccgatgcattagtgacgctatccgaagatgat
gtcaaagagatgctggaacaagatggcaatattgatatgaattgcgagtattgcggtact
cactacctgtttgatgcggtcgacattgccacattaaaaagcggtaacagcccttcatca
gaacaaattcattaa

DBGET integrated database retrieval system