KEGG   Yersinia enterocolitica 2516-87: CH48_1599Help
Entry
CH48_1599         CDS       T03644                                 

Gene name
sodA
Definition
(GenBank) superoxide dismutase Mn
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
yet  Yersinia enterocolitica 2516-87
Brite
Enzymes [BR:yet01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CH48_1599 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N HTH_54
Motif
Other DBs
NCBI-ProteinID: AJJ25812
UniProt: A9U908
LinkDB All DBs
Position
1787263..1787886
Genome map
AA seq 207 aa AA seqDB search
MSYSLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANTVLESFPELAKFSVEDLIKD
LDKVPAEKRTFMRNNAGGHANHSLFWKGLKLGTTLTGDLKAAIERDFGSVDSFKEKFEQA
AATRFGSGWAWLVLKDDGKLAVVSTANQDSPLMGEAVSGASGFPIVGLDVWEHAYYLKFQ
NRRPDYIKAFWNVVNWDEAAARFAQAK
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgagttactcactgccatccctgccttatgcttatgacgccctggaaccacacttcgat
aagcagacgatggaaatccatcacaccaaacaccaccaaacctatgttaacaatgcaaac
acggtgttggagagcttccctgagctggctaaattcagtgttgaagatctaatcaaagat
ctggacaaagttccagctgaaaaacgcacctttatgcgtaataacgctggcggtcacgct
aaccacagcctgttctggaagggcttgaaactgggcaccactctgaccggtgacctgaaa
gccgctattgagcgcgacttcggcagcgttgacagcttcaaagaaaaatttgaacaagct
gcggcaacgcgtttcggttcaggctgggcctggctggtactgaaagacgacggcaaactg
gctgttgtttcgactgctaaccaagacagcccgctgatgggtgaagctgtttctggcgca
tcaggtttcccgattgtgggcctggatgtgtgggaacacgcttactacctgaaattccaa
aaccgtcgcccagactacatcaaagcattctggaacgtggttaactgggacgaagcagcc
gcgcgcttcgctcaagctaagtaa

DBGET integrated database retrieval system