KEGG   Yersinia enterocolitica 2516-87: CH48_1798Help
Entry
CH48_1798         CDS       T03644                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase family protein
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
yet  Yersinia enterocolitica 2516-87
Pathway
yet00680  Methane metabolism
yet01100  Metabolic pathways
yet01120  Microbial metabolism in diverse environments
yet01200  Carbon metabolism
Module
yet_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:yet00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CH48_1798
  09102 Energy metabolism
   00680 Methane metabolism
    CH48_1798
Enzymes [BR:yet01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CH48_1798
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AJJ28365
LinkDB All DBs
Position
complement(2012280..2014919)
Genome map
AA seq 879 aa AA seqDB search
MNEQYSAMRSNVSMLGTLLGDTIKEALGEHILEKVETIRKLSKSSRAGNEASRQELLTTL
QNLSNDELLPVARAFSQFLNLTNTAEQYHSISPHGEAASNPEALAQLFTRLKDKKLSEQD
MRSAVDELSIELVLTAHPTEITRRTLIHKLVEVNTCLSQLDHNDLADYERNKIMRRLRQL
VAQSWHTDEIRKIRPSPVDEAKWGFAVVENSLWEGVPAFLREFNEQLQNSLDYRLPVEAV
PIRFTSWMGGDRDGNPNVTAEITRHVLLLSRWKATDLFLRDIQVLVSELSMSECTPELRE
LAGGEEVLEPYRELMKRVRTQLTNTQAYLEARLKGERVLPPTDLLVSNDQLWDPLYACYQ
SLKACGMEIIANGQLLDTLRRVRCFGVPLVRIDVRQESTRHTDAIAELTRYLGLGDYESW
SEADKQAFLIRELNSKRPLVPLKWEPSADTQEVLETCRVIAEAPQGSIAAYVISMAKVPS
DVLAVHLLLKEAGCPFTLPVAPLFETLDDLNNADDVMTQLLNIDWYRGLIQGKQMVMIGY
SDSAKDAGVMAASWAQYRAQDALIKTCEKAGISLTLFHGRGGSIGRGGAPAHAALLSQPP
GSLKGGLRVTEQGEMIRFKFGLPEVTISSLALYASAVLEANLLPPPEPKKEWNEVMDILS
DASCEMYRGYVRENPQFVPYFRAATPELELGKLPLGSRPAKRRPNGGVESLRAIPWIFAW
TQNRLMLPAWLGAGAGLQKAIDAGNKEVLATMCRDWPFFSTRIGMLEMVFAKADLWLAEY
YDQRLVDKSLWPLGQQLRDQLEADIKVVLAIANDDHLMADLPWIAESIALRNVYTDPLNV
LQAELLHRSRQQENAADARVEQALMVTIAGVAAGMRNTG
NT seq 2640 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattccgcaatgcgaagtaacgtcagtatgctcggtacgctactcggg
gacaccatcaaggaagcacttggtgaacacatccttgaaaaagtagaaaccatccgtaaa
ttatctaaatcttcgcgtgccggtaatgaggcgagccgtcaggagctactgacgacactg
caaaatttatccaacgacgaactgctgccggtcgcccgtgcttttagccaattcctcaat
ctgacgaatacggcagagcaatatcacagcatttcgccgcatggtgaagccgcgagtaac
ccggaagctctggcccaactgttcacccgcttaaaagacaaaaagctgagtgagcaagac
atgcgcagcgcggttgatgagctatccattgagctggtgctaacggctcacccaacggaa
attacccgccgcaccttgattcataaactggttgaagtgaatacctgcctgagccagttg
gatcacaacgatttagccgattacgaacgcaacaagatcatgcgtcgtttgcggcagtta
gtcgcacaatcatggcatactgacgaaattcgtaaaatccgcccttccccggtcgatgaa
gctaaatggggctttgctgtggttgaaaacagcttatgggaaggtgtgcccgctttcctg
cgtgaatttaacgagcaattgcaaaactccctcgattatcgcttgccggtagaagcggtg
ccgatccgcttcacttcatggatgggtggcgaccgtgacggtaatccgaatgtcaccgct
gaaattacccgccatgtgctattactaagccgctggaaagcgaccgatttattcctgcgc
gacattcaggtattggtgtcagagctttctatgtcggaatgtacgccggaactgcgtgaa
ttggcgggcggcgaagaggtgctcgaaccttatcgtgaactgatgaaacgcgtgcgtact
cagttgaccaatactcaggcttatctggaagcacgtctgaaaggtgagcgcgtattgcca
ccaacagatttgctggtcagcaatgaccaattgtgggatccgctatacgcttgttatcaa
tccctgaaagcttgtggcatggaaatcatcgccaacggccagttactcgataccttacgc
cgcgtgcgctgttttggtgtgccattggtgcgtatcgatgtgcgtcaggaaagcacccgt
cataccgatgctattgctgaactgacccgctatctgggcctcggtgattatgaaagctgg
tctgaagcggacaaacaagccttcttgatccgcgaactgaactccaagcgcccactggtt
ccgctgaaatgggaacccagtgccgacacccaagaagtgttagaaacctgccgggtgatt
gccgaagcgccgcaaggttctatcgccgcttatgtgatttccatggcgaaagtgccatcg
gatgtgctggcggtgcatttactgctgaaagaagctggctgcccattcactctgccagtc
gcgccattgttcgaaacactcgatgacctgaacaatgcggacgacgtgatgacccagtta
ctgaatatcgactggtatcgcggcctgatccaaggcaagcagatggtgatgattggctat
tctgactcagcgaaagatgccggtgtaatggccgcgtcctgggcacaatatcgggcgcaa
gatgcgctaattaaaacctgcgagaaagccggtatctccctgacactgttccatggtcgc
ggcggttctatcggccgtggtggtgcacccgcccatgccgcgctactttctcagcctccg
ggcagcctgaaaggtggcttacgcgtgactgaacagggtgagatgatccgctttaagttt
ggtctgccggaagtcaccatcagcagtctggccctgtatgccagtgctgtactggaagcc
aatttgttaccgccgccggaaccgaagaaagagtggaatgaggtgatggatattctgtct
gatgcctcttgtgagatgtatcgcggctatgttcgtgaaaatccacagttcgttccttac
ttccgcgccgccacccctgaactggaattgggcaagctgccattgggttcgcgcccagcc
aaacgccgcccgaatggcggggtggaaagcctgcgtgctattccgtggatctttgcctgg
acacaaaaccgcctgatgttaccggcctggctgggggccggtgccggtttacagaaagcc
atcgatgccggtaataaagaagtattagccaccatgtgtcgtgactggccgttcttctca
acccgcattggtatgctggaaatggtgtttgccaaagccgatttgtggttggccgaatat
tatgaccagcgtctggtggataaatcattgtggccgttaggacagcaattacgcgaccaa
ctggaagccgatattaaagtggtgctggctatcgccaacgacgaccacttgatggcggat
ttaccgtggattgccgagtcgattgcactgcgtaacgtctataccgacccactaaacgtg
ttgcaagcggaactgttgcaccgctcgcgccagcaagaaaatgccgcagatgcccgtgtt
gagcaggcgttgatggtgactattgctggggtggcggcagggatgcgtaataccggttag

DBGET integrated database retrieval system