KEGG   Yersinia enterocolitica 2516-87: CH48_2Help
Entry
CH48_2            CDS       T03644                                 

Gene name
fabF
Definition
(GenBank) beta-ketoacyl-acyl-carrier-protein synthase II
  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Organism
yet  Yersinia enterocolitica 2516-87
Pathway
yet00061  Fatty acid biosynthesis
yet00780  Biotin metabolism
yet01100  Metabolic pathways
yet01212  Fatty acid metabolism
Module
yet_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:yet00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CH48_2 (fabF)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CH48_2 (fabF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:yet01004]
    CH48_2 (fabF)
Enzymes [BR:yet01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.179  beta-ketoacyl-[acyl-carrier-protein] synthase II
     CH48_2 (fabF)
Lipid biosynthesis proteins [BR:yet01004]
 Fatty acid synthase
  Component type
   CH48_2 (fabF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AJJ27736
UniProt: A0A0E1NH36
LinkDB All DBs
Position
complement(1693..2931)
Genome map
AA seq 412 aa AA seqDB search
MSKRRVVVTGLGMLSPVGNTVESTWKAVLAGQSGISLIDHFDTSAYATRFAGLVKDFNCE
EFISRKDARKMDAFIQYGIVAGMQAMQDSGLEVTEANASRIGAAIGSGIGGLGLIEENHT
ALVNGGPRKISPFFVPSTIVNMIAGHLSIMCGMRGPSISIATACTSGVHNIGHAARIIAY
NDADVMLAGGAEKASTPLGVGGFGAARALSTRNDNPQAASRPWDKDRDGFVLGDGAGMMV
LEEYEHAKKRGAKIYAEVVGFGMSSDAYHMTSPPEDGSGAALAMVNALRDAGVSTSQIGY
INAHGTSTPAGDKAETQAVKSVFGGDTKVMVSSTKSMTGHLLGAAGAVESIFTVLALRDQ
AIPATINLDNPDEGCDLDFVPHEARQVTDLEYTLCNSFGFGGTNGSLVFRKV
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
gtgtctaagcgtcgagttgttgtgactggactgggcatgttgtctcctgtcggtaataca
gtcgaatccacatggaaagctgttcttgccgggcagagtggcatcagcctgatcgaccat
tttgatactagtgcctatgcaactcgatttgctggcttagtgaaagattttaattgtgaa
gagttcatttcgcgtaaagatgcgcgcaagatggacgcattcatacagtacggcattgtt
gctggcatgcaagccatgcaagactcagggcttgaagtcaccgaagccaatgctagccgt
atcggtgccgctataggttctggtattggtgggctgggtctgattgaagaaaaccacacc
gctctggtgaacggtgggccacgtaaaattagcccattcttcgtgccatcaaccattgtt
aacatgattgccggccacttgagcattatgtgtgggatgcgtgggccaagcatttctatc
gcaacggcatgtacttctggtgtgcataacatcggccacgcggcgcgtatcattgcttac
aatgatgcagatgtcatgctggcaggtggtgcagaaaaagccagtacgccattgggtgtc
ggtggttttggcgcggctcgtgcattgtcgactcgtaatgataatccgcaagcagcaagc
cgcccatgggataaagaccgtgatggtttcgtgctgggtgacggcgcaggcatgatggtg
ttggaagagtacgaacacgcgaaaaaacgtggcgcaaaaatctacgcggaagttgttggg
tttgggatgagcagcgatgcttatcacatgacctctccaccggaagacggttctggagca
gctctggcaatggtcaatgcattacgtgatgcgggtgtcagcacgtctcagatcggctat
atcaatgcccacggcacgtcaactcctgcgggcgataaagccgaaacgcaggcagttaag
tctgtatttggtggagacaccaaagtgatggtcagttccaccaaatccatgactgggcac
ttgttaggtgcagcaggcgcagttgagtctatctttactgtgttagcactgcgtgatcag
gccattccggcaactatcaacctggataacccagatgaaggttgtgatttggactttgtt
ccgcacgaagctcggcaggtcacagatttggaatacaccctgtgtaactccttcggcttt
ggtggcactaacggttctttggttttccgcaaagtataa

DBGET integrated database retrieval system