KEGG   Yersinia enterocolitica 2516-87: CH48_2061Help
Entry
CH48_2061         CDS       T03644                                 

Definition
(GenBank) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
yet  Yersinia enterocolitica 2516-87
Pathway
yet00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:yet00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CH48_2061
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:yet02000]
    CH48_2061
Enzymes [BR:yet01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CH48_2061
Transporters [BR:yet02000]
 Other Transporters
  Pores ion channels [TC:1]
   CH48_2061
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_N_4 GST_C_2
Motif
Other DBs
NCBI-ProteinID: AJJ27832
LinkDB All DBs
Position
2317946..2318617
Genome map
AA seq 223 aa AA seqDB search
MVIVHHLNNSRSQRILWMLEELQVPYELKRYQRDLGSLLAPPELKKIHPLGKSPVITDGD
LTLAESGAIIEYLQETYDAQGLFKPTGHYDRQQFRYWMHYAEGSLMPLLVMKLIFSRFGG
PPVPWIIRPVAKALGDGVQKNYLNKQIATHRAYLEQHLEKNQWFAGSDFSAADIQMSFPI
EAINMRGGLAGFPKLQDFLVRIHQRPAYQQAIEKGGAFKLENG
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atggtcattgttcaccatctgaataattcacgttcgcagcgtatcctgtggatgttggaa
gagttgcaagtcccctatgagttaaagcgttatcaacgtgatcttggcagcttgctggca
ccaccggagttgaaaaaaatccatcccttggggaaatcaccggtgattactgatggcgac
ctgacactggcggaatcgggtgccatcatcgagtatttgcaggaaacctatgatgcgcag
ggcttgtttaagcccaccggccattatgatcgccagcaatttcgttactggatgcattac
gcagaaggctccttgatgccattgctggtgatgaaacttatctttagccgcttcggtggg
ccacctgtgccgtggattattcgtccggttgccaaagccttgggtgatggggtgcagaaa
aattatctgaataagcaaattgccactcatcgcgcttatctggaacagcatctggaaaag
aatcaatggtttgctggcagcgattttagtgcggcagatattcagatgagttttcctatt
gaggcaataaatatgcgcggcggtcttgcggggttcccgaaactgcaagatttcttagtg
cgcattcatcagcgcccggcttatcaacaggcgattgaaaagggcggcgcgttcaaatta
gaaaacggataa

DBGET integrated database retrieval system