KEGG   Yersinia enterocolitica 2516-87: CH48_2225Help
Entry
CH48_2225         CDS       T03644                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
yet  Yersinia enterocolitica 2516-87
Pathway
yet00250  Alanine, aspartate and glutamate metabolism
yet00650  Butanoate metabolism
yet01100  Metabolic pathways
yet01110  Biosynthesis of secondary metabolites
yet01120  Microbial metabolism in diverse environments
yet02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:yet00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CH48_2225
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CH48_2225
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CH48_2225
   00430 Taurine and hypotaurine metabolism
    CH48_2225
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CH48_2225
Enzymes [BR:yet01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     CH48_2225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC CDC37_M
Motif
Other DBs
NCBI-ProteinID: AJJ29030
UniProt: A0A2X2N8P6
LinkDB All DBs
Position
2503673..2505073
Genome map
AA seq 466 aa AA seqDB search
MTRKSLDDYRSTLLDSRFGSQAIRNISENKEFPKEEMREDIAFQIISDELFLDGNARQNL
ATFCQTWDDDNVHKLMDLSINKNWIDKEEYPQSAAIDLRCVNMMADLWNAPTPKGGQGVG
TNTIGSSEACMLGGMAMKWRWRKKMEVAGKPTNKPNFVCGPVQICWHKFARYWDVEIREI
PMIPGQLFMDPKRMIEACDENTIGVVPTFGVTYTGNYELPKPLHEALDKLQKDTGLDIDM
HIDAASGGFLAPFVAPDIEWDFRLPRVKSISTSGHKFGLAPLGCGWVIWRDAAALPEELI
FNVDYLGGQIGTFAINFSRPAGQVISQYYEFIRLGREGYTKVQSACYQVAEFLAKEIAPL
GPYEFYFNGNPNEGIPAICFRIKEGAKPGYTLYDLSERLRLRGWQVPAFTLCGKMSDVVV
MRIMCRRGFEMDFAELLLDDYKASLKYLSEHPSLGGEASQNSFSHT
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgactagaaaatctctggatgattatcgctctacgttattagattctcgctttggttct
caagcgattcgcaatatctcggaaaataaagagtttcctaaagaggaaatgcgcgaggat
attgcttttcaaatcataagtgacgagctatttcttgatggtaatgcacgacaaaacctc
gcgacattttgccaaacgtgggacgacgataatgtccacaaactgatggatctttcgata
aataaaaactggattgataaagaggaatatccgcaatcggcggcaatagacttgcgttgt
gtaaatatgatggccgatttgtggaatgcccctacgccaaaaggcgggcaaggggtgggg
acaaataccattggttcttcagaggcttgcatgctcggcggcatggcgatgaagtggcgc
tggcgcaaaaaaatggaagtggcaggcaaacccacgaataaacctaattttgtttgtggg
ccggtacaaatttgctggcataaatttgctcgttattgggatgtcgaaatacgtgaaatt
cctatgatcccagggcaattatttatggacccaaaacggatgatagaggcgtgtgacgaa
aatactattggtgtggttccgactttcggcgtgacttacaccggcaattatgaattaccc
aaacctttacatgaggcactggataaactccagaaggataccggcctcgatattgatatg
catattgatgcggcgagtggcggatttttagcgccttttgttgcccctgatattgaatgg
gatttccgtttaccaagagtgaaatcaatcagcacttccgggcataaattcgggttagcg
cctttgggatgtggttgggttatttggcgtgatgccgccgctttacctgaagagctgata
tttaatgttgattatctcggcggccagatcggtacttttgcgattaacttctcgcgcccg
gcaggacaagttatttcccaatattacgaattcatacgattagggcgtgaaggctatacc
aaggtgcaaagtgcctgttatcaagtggcagaattcctagccaaagaaattgcaccactc
gggccttatgaattctatttcaatggcaacccaaatgagggcattcccgcgatttgtttc
cgcatcaaagaaggggccaagccgggatataccctatatgacctttccgagcgtttgaga
ctgcgtggttggcaagttccggcatttactttgtgcgggaagatgtctgatgtcgtagtt
atgcgcatcatgtgccgccgcggattcgagatggatttcgccgagctgttattagacgat
tataaagcttctctgaaatatctaagtgagcatccatcccttgggggcgaagcaagtcag
aatagttttagccatacataa

DBGET integrated database retrieval system