KEGG   Yersinia enterocolitica 2516-87: CH48_2227Help
Entry
CH48_2227         CDS       T03644                                 

Gene name
glsA
Definition
(GenBank) glutaminase A
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
yet  Yersinia enterocolitica 2516-87
Pathway
yet00220  Arginine biosynthesis
yet00250  Alanine, aspartate and glutamate metabolism
yet00471  D-Glutamine and D-glutamate metabolism
yet01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yet00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CH48_2227 (glsA)
   00220 Arginine biosynthesis
    CH48_2227 (glsA)
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    CH48_2227 (glsA)
Enzymes [BR:yet01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     CH48_2227 (glsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: AJJ28397
LinkDB All DBs
Position
2506774..2507718
Genome map
AA seq 314 aa AA seqDB search
MTIDRVRLNQVIKDAHSQYSTLAGGENASYIPYLASVSSKLAAVVVVTVDGDIISQGDAD
FRFALESISKVCSLALALEDIGPQAVQDKIGADPTGLPFNSVIALELHNGKPLSPLVNAG
AMSTVSVIKASSREDRWARILDIQQQLAGAPIALSDEVNHSEQTTNFHNRAIAWLLYSAQ
AMYCDPMEACDVYTRQCSTLFNTIELATMGATFAAGGKNPVTKKQVLTASNMPFILAEMT
MEGMYGSSGDWAYTVGLPGKSGVGGGILAVVPGVMGIAAFSPPLDPVGNSVRGQKMVASV
AQQLGYNLYKGPLL
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgactattgaccgcgttcgcctgaatcaagttattaaagatgcccattcacaatattcc
actctcgctggaggggagaatgccagctatattccgtatttggccagtgtttccagtaaa
ttagccgcagtggtggttgtcactgttgatggcgatattatttcacaaggtgatgccgat
tttcgctttgcattagagtctatttccaaagtctgctctcttgctttggcattagaagat
attggcccacaagccgtgcaagacaaaataggcgctgaccccaccggcttaccttttaat
tcggtgattgcattagaactgcataatggcaagccattgtcaccattagtcaatgcgggg
gcgatgtccaccgtgagtgtaattaaagccagcagtcgagaagatcgctgggcgcgtatt
ttggatattcagcagcaactggcgggtgcgccgattgcactttcggatgaagttaaccat
tcagagcaaaccaccaactttcataatcgggccattgcctggctgctttattcggcccaa
gccatgtattgcgatccgatggaagcctgtgacgtttatacccgccagtgctcaacatta
ttcaatactattgaattggcaactatgggagcaactttcgcggcgggtggcaaaaatcct
gtgaccaaaaaacaggtattaacagcttccaatatgccatttattttggctgaaatgacg
atggaaggaatgtacggcagctcaggtgattgggcttataccgtcgggttaccgggtaaa
agcggtgtcggcggcggaatattggcggttgtgccgggtgtcatggggattgctgcattc
tcaccgccgcttgacccagtgggtaatagtgttcgcggccagaaaatggtggcgtctgtg
gcgcagcagttgggatataacttatataaaggcccgcttttgtaa

DBGET integrated database retrieval system