KEGG   Yersinia enterocolitica 2516-87: CH48_2459Help
Entry
CH48_2459         CDS       T03644                                 

Gene name
sodC
Definition
(GenBank) superoxide dismutase Cu-Zn
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
yet  Yersinia enterocolitica 2516-87
Brite
Enzymes [BR:yet01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CH48_2459 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AJJ26831
LinkDB All DBs
Position
2748974..2749498
Genome map
AA seq 174 aa AA seqDB search
MKLKYLLLPAMLFTGSVLAAGVTVTMNEALPDGNGKALGTVTVTETPYGLLFTPNLTGLV
AGIHGFHLHENPSCAPGQKEGKAVPALAAGGHFDPQKTGTHLGPYSDKGHLGDLPGLVVN
ADGTATYQVLAPRLKSLSEVKQHALMIHAGGDNYADHPMPLGGGGARMACGVIE
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgaaatacctactgttaccggcgatgcttttcactggcagtgtgctggctgcc
ggggttaccgtgaccatgaatgaagcgctgccagacggaaatggcaaagcgctgggcact
gttaccgtgacagaaaccccttatggtttgctgttcacgccaaatctgactgggctggtt
gcgggtattcatggtttccacctccatgagaatccaagttgtgcgccggggcagaaagag
ggtaaagctgtgcccgcattggctgcgggtggccatttcgatccgcaaaaaaccgggaca
caccttgggccttatagtgataaagggcacttgggtgacttgccggggctggtggtcaat
gccgatggcactgctacctaccaagtattggctccgcgtctgaaatcgctatcagaggtg
aaacagcatgcgctaatgattcatgctggtggtgataactatgctgaccatcccatgcct
ttgggggggggcggtgcgcgaatggcttgtggtgtcattgagtaa

DBGET integrated database retrieval system