KEGG   Yersinia enterocolitica 2516-87: CH48_3669Help
Entry
CH48_3669         CDS       T03644                                 

Gene name
sodB
Definition
(GenBank) superoxide dismutase Fe
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
yet  Yersinia enterocolitica 2516-87
Brite
Enzymes [BR:yet01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CH48_3669 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AJJ26008
UniProt: A0A0E1NA28
LinkDB All DBs
Position
complement(4033085..4033663)
Genome map
AA seq 192 aa AA seqDB search
MSFELPTLPYAQNALEPHISAETLEYHYGKHHNTYVVNLNNLIKDTEFAGQSLEEIVKTS
SGGIFNNAAQVWNHTFYWHCLSPNGGGEPTGKVADAINQSFGSFAEFKAQFTDAAVKNFG
AGWTWLVKKSDGTLAIVSTSNAATPLTTADKPLLTVDVWEHAYYIDYRNARPKYLENFWA
LVNWSFVEKNLA
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttgaattaccgacattaccttatgcacaaaatgcactggaaccgcacatttct
gctgaaacgctggaataccattacggtaagcaccacaacacttatgtggtaaacctcaat
aacctgatcaaggatactgagtttgcaggtcagtccttggaggagattgtcaaaacctcc
agtggcggtatttttaacaatgcagctcaagtttggaaccacaccttttactggcactgt
ttgtcacctaatggcggcggcgaaccgacaggaaaagtcgccgatgccattaatcaatcc
tttggatcttttgctgaatttaaagcgcaatttactgatgcggcggtaaaaaactttggc
gcgggctggacctggctggtcaaaaaatcggatggcacgttagctattgtcagcacatca
aatgcggcgacaccgctgacgaccgctgataagccattgttaactgtagatgtgtgggag
cacgcttactatattgattatcgtaatgcgcgaccaaaatatctggagaatttctgggcg
ctggtgaattggtctttcgttgagaaaaacttagcctga

DBGET integrated database retrieval system