KEGG   Yersinia enterocolitica 2516-87: CH48_3690
Entry
CH48_3690         CDS       T03644                                 

Gene name
gstB
Definition
(GenBank) glutathione S-transferase GST-6.0
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
yet  Yersinia enterocolitica 2516-87
Pathway
yet00480  Glutathione metabolism
yet01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yet00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CH48_3690 (gstB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:yet02000]
    CH48_3690 (gstB)
Enzymes [BR:yet01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CH48_3690 (gstB)
Transporters [BR:yet02000]
 Other transporters
  Pores ion channels [TC:1]
   CH48_3690 (gstB)
SSDB
Motif
Pfam: GST_C GST_N GST_C_3 GST_N_2 GST_N_3 GST_C_2 GST_N_5 GST_C_6 Jiv90
Other DBs
NCBI-ProteinID: AJJ29064
LinkDB
Position
complement(4051513..4052121)
AA seq 202 aa
MKLFYKPGACSLSPHIVLREAGLDFSIESVDLATKKTETGEDYLHINPKGQVPALLLDDG
SLLTEGVAIVQYLADKVPDRHLIAPSGTLSRYHAIEWLNFVATELHKGFSPLFNPKTPDE
YKAIARERLDKQFSYVDGVLAKHDYLLGSKFSVADAYLFTVTRWATALKLEIKQRSHLDK
YMARVAERPAVKAALAAEDVKK
NT seq 609 nt   +upstreamnt  +downstreamnt
atgaaattgttctataaacccggtgcctgctctttgtctccccatattgtgttacgtgaa
gcggggctagacttcagtattgaaagtgtcgatttggcgactaaaaaaactgaaacgggt
gaagactatttgcacatcaacccgaaaggacaagtgcctgctctgctactggatgacgga
agcctgctcactgaaggtgtggctatcgtgcaatatctggcggataaggtgcctgatcgc
cacctgattgcaccatcaggcaccctttcccgttaccacgccattgagtggttaaacttc
gttgcgactgaattacataaaggtttcagcccgctgtttaacccgaaaacaccagacgaa
tataaagctatcgcccgtgaacggctggataagcaattcagctatgtcgatggcgtatta
gcaaagcatgattatctgttaggctcaaaattcagcgtagccgatgcttatctatttacc
gtaacccgctgggcaactgcactgaaacttgaaattaaacagcgcagccatttagataaa
tatatggcgcgggtagcagagcgtccggcagtcaaagcggcgctcgcagcagaagacgtg
aagaaataa

DBGET integrated database retrieval system