KEGG   Yersinia enterocolitica 2516-87: CH48_3932Help
Entry
CH48_3932         CDS       T03644                                 

Definition
(GenBank) thymidine kinase family protein
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
yet  Yersinia enterocolitica 2516-87
Pathway
yet00240  Pyrimidine metabolism
yet01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yet00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    CH48_3932
Enzymes [BR:yet01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     CH48_3932
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22
Motif
Other DBs
NCBI-ProteinID: AJJ26366
UniProt: A0A0E1ND96
LinkDB All DBs
Position
complement(4306584..4307183)
Genome map
AA seq 199 aa AA seqDB search
MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTLVFTAEIDNRFGVGTVSSRIGLSSQAL
LYNSGTSLLSIITTEHQEKPVHCILLDECQFLTKDQVQELCQVVDELHIPVLCYGLRTDF
LGELFPGSKYLLSWADKLVELKTICHCGRKANMVLRLDAQGRAVHDGEQVVIGGNESYVS
VCRRHYKEAIKAACLQQYP
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggctcaactttatttttattattcagcaatgaatgcaggcaaatccaccgcgctattg
cagtcttcttataactaccaagagcgtggcatgcgcacgctggtttttaccgcggagatt
gataatcgctttggggtcggaacggtcagttcgcgtattggcctgtcttcacaagccctg
ctttacaatagcggcacatcattattatctattatcaccacagagcatcaggagaaacct
gttcattgtattttacttgatgagtgtcagtttctgaccaaagatcaggttcaggaattg
tgccaggtagtagatgaattacatatccctgtgttgtgttacggcctgcgcactgatttc
ctcggtgagttattccccgggagtaaatacttgttgtcatgggccgacaaattagtcgaa
ttaaagacgatttgtcattgtgggcgcaaagcaaacatggtgttacgtttggatgcacag
gggcgagcagtgcacgatggtgaacaagtcgtcattggggggaatgaaagctacgtttcg
gtttgtcgccgccattataaagaagctattaaagcggcttgtctccagcaatatccttaa

DBGET integrated database retrieval system