KEGG   Yersinia enterocolitica 2516-87: CH48_4106Help
Entry
CH48_4106         CDS       T03644                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
yet  Yersinia enterocolitica 2516-87
Pathway
yet00020  Citrate cycle (TCA cycle)
yet00480  Glutathione metabolism
yet01100  Metabolic pathways
yet01110  Biosynthesis of secondary metabolites
yet01120  Microbial metabolism in diverse environments
yet01130  Biosynthesis of antibiotics
yet01200  Carbon metabolism
yet01210  2-Oxocarboxylic acid metabolism
yet01230  Biosynthesis of amino acids
Module
yet_M00009  Citrate cycle (TCA cycle, Krebs cycle)
yet_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:yet00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CH48_4106 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CH48_4106 (icd)
Enzymes [BR:yet01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     CH48_4106 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh tRNA_synt_1c_R1
Motif
Other DBs
NCBI-ProteinID: AJJ26668
UniProt: A0A0E1NBY5
LinkDB All DBs
Position
complement(4493109..4494362)
Genome map
AA seq 417 aa AA seqDB search
MESKVVVPAEGKKITVDAQGKLVVPHNPIIPFIEGDGIGVDVTPAMINVVDAAVKKAYNG
ERKISWMEIYTGEKSTHVYGKDVWLPEETLDLIREYRVAIKGPLTTPVGGGIRSLNVALR
QQLDLYVCLRPVRYYEGTPSPVKHPELTNMVIFRENAEDIYAGIEWKAGSPEAEKVIKFL
REEMGVKKIRFPEQCGIGVKPCSEEGTKRLVRAAIEYAITNDRESVTLVHKGNIMKFTEG
AFKDWGYQLAREEFGGELIDGGPWVKIKNPNNGKDIIVKDVIADAFLQQILLRPAEYDVI
ACMNLNGDYISDALAAQVGGIGIAPGANIGDECALFEATHGTAPKYAGQDKVNPGSIILS
AEMMLRHMGWFEAADLIIKGTEGAIQAKTVTYDFERLMEGAKLLKCSEFGDAIIKHM
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcaaagtagttgttccggcagaaggtaagaaaattactgtcgatgctcagggt
aaactggttgttccgcataatccgatcattccatttattgaaggtgatggcattggcgtt
gatgtgaccccagccatgatcaacgtggtggatgctgcggttaagaaggcctataacggt
gagcgtaaaatctcctggatggaaatttacaccggtgagaaatcaactcatgtttatggc
aaagatgtctggctgccggaagaaacattggacttgattcgtgagtaccgcgttgcaatt
aaaggcccattgaccactccagtgggtggcggtattcgttctctgaacgttgctttgcgc
caacaactcgacttgtatgtgtgcctgcgcccagtgcgttattacgaaggtaccccaagc
ccggtaaaacaccctgaattgaccaatatggtgattttccgcgaaaacgcagaagatatc
tatgcgggtattgaatggaaagccggttcaccagaagctgaaaaagtgattaagtttctg
cgtgaagagatgggtgtgaagaaaattcgcttccctgaacaatgtggtattggtgtaaaa
ccatgttcagaagaagggactaagcgtttggtacgtgctgcaattgagtatgcaattacc
aacgatcgtgaatcagtcactctggttcataaaggcaacattatgaaattcaccgaaggt
gcatttaaagactggggttaccagttagcgcgtgaggaatttggtggtgagctgatcgat
ggcggcccttgggttaaaatcaagaatccaaacaacggtaaggatatcattgttaaagat
gtgattgccgatgctttcctgcaacagatcctgctgcgtccggctgaatatgatgttatc
gcgtgtatgaacctgaatggggattacatttctgatgcattggctgctcaagttggcggt
atcggtattgccccaggtgctaacattggtgatgagtgcgcattgtttgaagcgactcat
ggtacggcacctaaatatgcgggtcaggataaagtgaacccaggttctattattctgtcc
gcagaaatgatgctgcgtcacatgggctggttcgaagccgcagacctgattatcaaaggc
accgaaggtgcaattcaggccaagacggtcacttatgatttcgaacgtctgatggaaggc
gctaagttactgaaatgcagtgaatttggtgacgccattattaagcacatgtaa

DBGET integrated database retrieval system