KEGG   Yersinia enterocolitica 2516-87: CH48_929Help
Entry
CH48_929          CDS       T03644                                 

Definition
(GenBank) D-alanine--D-alanine ligase family protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
yet  Yersinia enterocolitica 2516-87
Pathway
yet00473  D-Alanine metabolism
yet00550  Peptidoglycan biosynthesis
yet01100  Metabolic pathways
yet01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:yet00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CH48_929
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CH48_929
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    CH48_929
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:yet01011]
    CH48_929
Enzymes [BR:yet01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CH48_929
Peptidoglycan biosynthesis and degradation proteins [BR:yet01011]
 Precursor biosynthesis
  Amino acid ligase
   CH48_929
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATPgrasp_ST ATP-grasp_3 ATP-grasp RimK ATPgrasp_Ter TTL ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: AJJ26224
LinkDB All DBs
Position
complement(1031808..1032728)
Genome map
AA seq 306 aa AA seqDB search
MAEKVAVLLGGTSAEREVSLLSGEAVLAGLREAGIDAHGIDTKDFPVTQLKEQGFDKVFI
ALHGRGGEDGTLQGVLEFLQLPYTGSGVMASALTMDKLRTKLVWQASGLPISPYVALNRQ
QFETLSSEELAACVAKLGLPLIVKPSHEGSSVGMSKVDQANQLHSALVEAFRHDTDVLIE
KWLSGPEFTVAILGNDVLPSIRIQAPGVFYDYEAKYLSDETQYFCPSGLSSELEQQLAAL
SLQAYQALGCSGWGRVDVMQDSDGCFYLLEVNTSPGMTSHSLVPMAARQHGLSFSQLVAR
ILTLAD
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaaagttgcggtactgctgggtgggacctctgctgaacgtgaagtgtcattg
ttatcaggcgaggcggtattagcgggcttgagagaggctggtatcgatgctcatggtatc
gatactaaagacttcccggtgacacagcttaaagagcaaggttttgataaggtctttatc
gctttgcatgggcgcggtggtgaagacggtacgctgcaaggggtgttggagtttctgcaa
ctaccttataccggcagtggtgtgatggcttccgccctgacaatggacaaattgcgtacc
aaattggtatggcaagcttcaggtttgccaatttcgccttatgtcgcgctaaatcgtcaa
cagtttgaaacactttcgtcagaggaattggcggcgtgtgtcgctaagcttggcctgcca
ttaatcgttaagccaagtcatgaaggctctagcgtaggaatgagcaaggttgatcaggcg
aatcaattgcattctgctctggttgaagctttccgtcacgacactgatgtgctgattgag
aaatggttgagtgggccagaatttaccgtcgcgatccttggtaatgatgttctaccgtcg
attcgcattcaggctcccggtgtgttctatgattatgaagccaagtatctatctgatgaa
acacagtatttttgcccaagtggtttgagttctgaattagaacaacagttggctgcattg
tcattacaggcttatcaggcattggggtgcagcggctggggccgagttgacgttatgcaa
gatagcgatggctgtttctacctgcttgaagtgaatacttcaccgggtatgaccagccac
agtttagtgccgatggctgcccgccaacatgggttgagtttttcccagttggtggcccga
attctgacgttggctgactaa

DBGET integrated database retrieval system