KEGG   Yersinia enterocolitica WA: CH47_1569Help
Entry
CH47_1569         CDS       T03643                                 

Gene name
gst
Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
yew  Yersinia enterocolitica WA
Pathway
yew00480  Glutathione metabolism
yew01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yew00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CH47_1569 (gst)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:yew02000]
    CH47_1569 (gst)
Enzymes [BR:yew01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CH47_1569 (gst)
Transporters [BR:yew02000]
 Other transporters
  Pores ion channels [TC:1]
   CH47_1569 (gst)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N GST_C_3 GST_N_2 GST_N_3 GST_C_2 GST_C_6
Motif
Other DBs
NCBI-ProteinID: AJI82132
UniProt: A0A0T9S6Q9
LinkDB All DBs
Position
1640648..1641256
Genome map
AA seq 202 aa AA seqDB search
MKLFYKPGACSLSPHIVLREAGLDFSIESVDLATKKTETGEDYLRINPKGQVPALLLDDG
SLLTEGVAIVQYLADKVPDRHLIAPSGTLSRYHAIEWLNFIATELHKGFSPLFNPKTPDE
YKAIARERLDKQFSYVDGVLAKHDYLLGSKFSVADAYLFTVTRWATALKLEIKQRSHLDK
YMARVAERPAVKAALAAEDGKK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgttctataaacccggtgcctgctctttgtctccccacattgtattacgtgaa
gcggggctagacttcagtattgaaagtgtcgatttggcgactaaaaaaactgaaacgggt
gaagactatttgcgcatcaacccgaaaggacaagtgcctgctctgctactggatgacgga
agcctactcactgaaggtgtggctatcgtgcaatatctggcagataaagtgcctgatcgc
cacctgattgcaccatcaggcaccctttcccgctaccacgccattgagtggttaaacttc
attgcgactgaattacataaaggtttcagcccgctgtttaacccgaaaacaccagacgaa
tataaagctattgcccgtgaacggctggataagcaatttagctatgtcgatggcgtatta
gcaaagcatgattatctgttaggctcaaaattcagcgtagccgatgcttatctatttacc
gtaacccgctgggcaactgcactgaaacttgaaattaaacagcgcagccatttagataaa
tatatggcgcgggtagcagagcgtccggcagttaaagccgcgctggcagcagaagacggg
aagaaataa

DBGET integrated database retrieval system