KEGG   Yersinia enterocolitica WA: CH47_2004Help
Entry
CH47_2004         CDS       T03643                                 

Definition
(GenBank) binding--dependent transport system inner membrane component family protein
  KO
K02011  iron(III) transport system permease protein
Organism
yew  Yersinia enterocolitica WA
Pathway
yew02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:yew00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CH47_2004
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:yew02000]
    CH47_2004
Transporters [BR:yew02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Iron(III) transporter
    CH47_2004
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AJI84877
UniProt: A0A0T9SQ55
LinkDB All DBs
Position
2129022..2131100
Genome map
AA seq 692 aa AA seqDB search
MTHSHALRLPQTRDTIFYWLAFAVAAFALLPAFSLDYGLLEASRSELLAAYGWSSLNIST
LWFALPLVLLFRPLSPQGREHRTRHLFDAGFALFCALFVVITSAWLQRGLGFATIGLFIA
LGAVITLALARLEWLGGDRFVLGSLVTIIALITVFILFPSIAIFIPIFTDESGAFAPWQF
MAILGQAHILQVIWNSFVLSVAVGIGCTFFGMVLAIYTTRIAKRSALLGRIFSILPIVTP
PFVVGLGVTLMMGRSGYVTELMVTWFGLTNTNWLYGFTGIWLAQVLAFTPMSFMILDGAI
KTIHPSLEEASYTLRASRWQTFMQVFLPLLKPALANSFLIVIVQSLADFSNPLVLGGNFD
VLATQIYFYITGAQLDYPAASTLGVILLMFSLFIFCIQYMWIGKRSYVTISGKSSRGDVQ
PLPVSLVWGTTAMLYVWIAFNVLLYGSIFYGSFTVNWGVDYTLTLNNFNQLFGQGFSDGA
WPSLLDTLLYAGIAAPITAAFGLLIAYIVVRQQFRGKKTIEFSTMLCFAVPGTVAGVSYI
LAFNSAPVYLTGTAAIVIISMVMRNVPVGIRAGIAGLGQLDKSLDEASLSLRAGSLRTVI
YILLPLLRPAILSALIYSFVRAMTTVSAIVFLVTPDTRVATSYILNRVEDGEYGIAIAYG
SILIVVMLAIIFLFDYLVGEARIARSKASNAE
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atgactcactcacatgctctgcggctcccgcagacacgggataccattttctattggttg
gcctttgccgtggctgcttttgccttattacccgcgttcagtctggattatggtctgctt
gaggccagccgttctgagctactggccgcctatggctggtccagtctgaacatcagcaca
ttatggtttgccttaccattagtgctgcttttccggccactgtccccacaaggacgcgaa
caccgcacccgacatctgtttgatgccggtttcgccctattctgcgctctgttcgtggtc
atcacttcggcctggctgcaacgcgggctgggttttgccacgattggcttgtttattgcc
ctgggagccgtcatcacactggcgctcgctcgcctggaatggctgggaggcgatcgtttt
gtcctcggttcgctagtcaccattattgccctgatcaccgtgtttatcctgtttcccagt
atcgctattttcattcccatctttacggatgaaagtggggcttttgcgccctggcaattt
atggcgatccttgggcaggctcatatcctgcaagttatctggaattcatttgtgctatcg
gtggcggtcggtatcggttgtaccttctttggcatggtgttagccatatacaccacgcga
attgctaaacgctccgcattgctggggcgaattttctcgattttgccgattgtcaccccg
ccttttgtggttggcttgggtgtcaccttgatgatgggccgctccggttacgtgaccgaa
ttaatggtcacctggttcgggctgacaaatactaactggctttatggttttaccggtatc
tggttggcgcaagtactggcctttacgccgatgtcatttatgatcctcgatggcgcgata
aaaacgattcacccgtcgctggaagaagcctcttataccttgcgggccagccgttggcag
acctttatgcaggtatttctgccgctattgaaaccggctctggcgaactcattcttaatt
gtcatcgtgcaatcactggctgatttcagtaacccactggtattaggcgggaactttgac
gtgctcgccacgcaaatctacttctatattaccggcgcacaacttgactatccggcagcg
tcgacactgggtgtcatcctgctgatgttctcgctgtttatcttctgtattcagtatatg
tggataggcaaacgctcctacgtcaccatctccggtaaatcttcgcgcggtgatgttcaa
cccttgccggtctcattagtctggggcacaacagccatgctgtatgtgtggattgccttt
aacgtattgctgtacggcagcattttctatggcagtttcactgtcaactggggagtcgat
tacaccctgacgctaaataacttcaaccagttatttgggcaaggtttcagtgatggcgca
tggccttcgctgctcgatacgctgttatacgccggtattgccgcccctatcaccgccgcc
tttggtctgctgattgcctatatcgtggtacgtcagcaattccgtggcaaaaaaaccatc
gaattcagcaccatgctctgtttcgccgtacccggaaccgtggcgggcgtctcctatatt
ctggcctttaacagtgcgccggtgtacctgaccggtacggcagctatcgtcattatttca
atggtgatgcgcaatgtgcccgtcgggatacgcgctgggattgctggtctgggccaactt
gataaatcgctggatgaggcctcactcagcttgcgggccggttcgctacgtaccgtgatt
tacattttgctgccattactgcgcccggcaattctatcagcactgatttatagttttgtg
cgggcgatgaccactgtcagtgccattgttttcctggtaacgccggacacccgagtcgcc
acctcttacatccttaaccgggtagaagatggcgaatacggtatcgcgattgcctatggc
tccatcctgattgtggtgatgcttgccatcatcttcctgtttgattacctggttggcgaa
gcgcgtattgcccgctcgaaagccagtaatgctgaataa

DBGET integrated database retrieval system