KEGG   Yersinia enterocolitica WA: CH47_270Help
Entry
CH47_270          CDS       T03643                                 

Gene name
fabZ
Definition
(GenBank) beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
yew  Yersinia enterocolitica WA
Pathway
yew00061  Fatty acid biosynthesis
yew00780  Biotin metabolism
yew01100  Metabolic pathways
yew01212  Fatty acid metabolism
Module
yew_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:yew00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CH47_270 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CH47_270 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:yew01004]
    CH47_270 (fabZ)
Enzymes [BR:yew01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     CH47_270 (fabZ)
Lipid biosynthesis proteins [BR:yew01004]
 Fatty acid synthase
  Component type
   CH47_270 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas PS-DH 4HBT_3 4HBT
Motif
Other DBs
NCBI-ProteinID: AJI84927
LinkDB All DBs
Position
285465..285971
Genome map
AA seq 168 aa AA seqDB search
MTTDTHTLHIEEILDLLPHRFPFLLVDRVLDFEEGKFLRAVKNVSFNEPFFQGHFPGKPI
FPGVLILEAMAQATGILAFKSRGKLEPGELYYFAGIDEARFKRPVVPGDQMIMEVEFVKE
RRGLTRFTGVAKVDGEIVCTATMMCARSKPATAVVTKSEVTKPDVKES
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
ttgactactgacactcatactctgcacattgaagagattttggatctactgccgcaccgt
tttccgtttttgctggtagatcgcgtccttgattttgaggaaggaaaatttctgcgtgcg
gtgaagaacgtctctttcaacgagccatttttccaaggccatttcccaggtaagccaatc
ttccctggtgtgctgatattagaagcgatggctcaggctaccgggattttggcgtttaag
agccgcggtaaacttgaaccaggtgagctttattattttgctggtatcgatgaagcccgc
tttaaacgtccagtagtgcctggcgatcaaatgatcatggaagttgagtttgttaaagaa
cgccgtggtctgacccgttttactggtgttgcgaaagttgatggtgaaattgtttgtacg
gcaaccatgatgtgtgctcgtagcaaaccagcaacagctgtagttacaaagtctgaagtt
acaaagcctgacgttaaggagtcttga

DBGET integrated database retrieval system