KEGG   Yersinia enterocolitica WA: CH47_2845Help
Entry
CH47_2845         CDS       T03643                                 

Definition
(GenBank) DNA polymerase family B, exonuclease domain protein
  KO
K02336  DNA polymerase II [EC:2.7.7.7]
Organism
yew  Yersinia enterocolitica WA
Brite
KEGG Orthology (KO) [BR:yew00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:yew03400]
    CH47_2845
Enzymes [BR:yew01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     CH47_2845
DNA repair and recombination proteins [BR:yew03400]
 Prokaryotic Type
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    CH47_2845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol_B DNA_pol_B_exo1 DNA_pol_B_2 RNase_H_2 P63C
Motif
Other DBs
NCBI-ProteinID: AJI83333
UniProt: A0A0T9S9E3
LinkDB All DBs
Position
3070023..3072395
Genome map
AA seq 790 aa AA seqDB search
MAQHRQGFLLTRHWRDTQAGTEVEFWLATDEGPQQVRLPPQPSVAFIPAEQRQRAETVLR
DERRWQLRPLELTDFHQRPVLGLYCNQHRQLIRLEKLLKESGVNVYEGDIRPPERFLMER
FITAPVWFSGEDNGNGPLLNTQMKPADDYRPTLKLVSLDIETSEHGELYCIGLEGCGQRQ
VYMLGPPNGNQADETALDFNLEYVASRPLLLEKLNQWLELHDPDAIIGWNLVQFDLRVLQ
KHADRYQIPLRFGRGGNLLEWREHGFKQGHFFASAAGRLIIDGIEALKSATWNFPSFSLE
SVSQTLLGEGKASDSPYQRMDEINQRFAHDKPALARYNLKDCELVTRIFAKTELLSFLLE
RATVTGLAADRSGGSVAAFTHLYMPRMHRIGYVAPNLGELPEEHSPGGFVMDSQPGLYDS
VLVLDYKSLYPSIIRTFLIDPVGLVVGMSQPDEQHAVPGFRGAWFSREKHCLPAIVNQIW
QGREAAKRQQNKPLSQALKIIMNAFYGVLGSSGCRFFDPRLASSITMRGHEIMRKTRELI
EARGYQVIYGDTDSTFVWLKNAHSEEQAASIGQELVQYVNQWWQTHIRETFDLPCALELE
FETHYRRFLMPTIRGAEQGSKKRYAGLISTPAGDQMIYKGLETVRTDWTPLAQQFQRELY
LKIFQQQPYQDYVRDYVARTLNGELDEQLIYRKRLRRRLDDYQRNVPPHARAARLADEFN
RKLGRPLQYQNGGWISYVMTTAGPEPLETRQSPIDYDHYLTRQLQPVADAILPFMHDDFT
TLITGQMGLF
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcaacaccgtcagggcttcctgctcacccgccactggcgcgacacgcaggcaggc
accgaagttgaattctggttagctaccgatgaaggcccgcagcaagtcaggctgccgcct
caaccctcggtagcgtttatcccggccgaacagcggcaacgggctgaaaccgtgctgcgt
gatgagcgccgctggcaactgcgcccgcttgaactgaccgatttccatcaacgtccggtg
ctggggctatattgcaatcagcatcgtcaattaatccgcctggaaaaactgctcaaagaa
agcggagtgaatgtctacgaaggtgatattcgtccgcctgagcgctttctcatggagcgt
tttattaccgcgccggtctggtttagcggcgaagataatggcaatggcccactgctcaat
acccaaatgaagcctgccgatgactatcgcccgacactaaagctggtgtcgctggatatc
gaaaccagcgaacacggcgagctttattgtattggtttggaaggctgcggccagcggcag
gtatacatgttggggccgcccaatggcaatcaggccgatgaaacggcgctggatttcaat
ctggaatatgtcgccagccgcccgctattattggaaaaactcaaccaatggctggaactg
cacgatcccgatgccattatcggctggaatctggtgcaatttgacttgcgcgtgttacaa
aagcacgccgaccgctatcaaatcccactgcgctttggccgtggcggtaacttgctggag
tggcgggagcacggttttaagcaggggcacttttttgcttcggccgcgggtcggttaatc
attgatggcattgaagcattgaaatccgccacctggaatttcccgtcgttcagcctggaa
tcggtgtcgcaaaccttattgggcgaaggtaaagccagtgatagcccctatcagcggatg
gacgaaatcaatcagcgctttgcccatgataaaccggctctggcgcgctataacttgaaa
gattgtgaactggtgacgcggatttttgccaaaaccgaattactcagcttcttacttgag
cgagcaacggtcaccgggttggccgcggatcgcagtggcggctcagtcgcagccttcacc
cacctttatatgccacgcatgcaccgtatcggctatgttgcgcccaatttaggcgagttg
ccggaagagcacagccccggcggctttgtgatggattctcagccaggattgtatgactcg
gtactggtactcgactacaaaagcttatatccctcgattatccgcactttcttaattgat
ccggtgggattggtagtgggaatgtcccagcctgatgagcaacatgctgtgcccggtttc
cgcggggcttggttctcgcgcgaaaagcactgcctgccagcaattgttaaccagatctgg
caaggtcgggaagcggcaaaacgtcagcaaaacaagccattatcccaagccctaaagata
atcatgaatgccttttatggtgttctgggttccagcggatgccgttttttcgaccccaga
ttggcttcgtcaattacgatgcgcggccacgaaattatgcgaaaaacccgcgaattaatt
gaagcacggggctatcaggtcatttatggcgataccgactcaacctttgtttggctgaaa
aacgcccacagtgaagaacaggccgccagtatcggccaagagctggtgcagtatgtgaat
caatggtggcaaacccatatccgtgaaacctttgatctgccctgtgctcttgaattggaa
tttgaaacccactatcgacgttttttgatgcccaccatccgaggtgcagaacaaggcagt
aaaaagcgctatgccgggttgatttcaacccctgcgggtgaccagatgatctataagggg
ttggagacggtacgcacggattggacacctctggcccagcaattccagcgcgaactgtat
ctaaagatctttcagcagcaaccttatcaggactatgtacgggattatgtcgcccgcacc
ctcaatggcgaactagacgaacaactaatttaccgtaaacgcctgcgccgccggctggat
gactaccagcgcaatgtcccacctcatgccagagctgcccgtctggcggatgagtttaac
cgcaagcttgggcggccattgcaatatcaaaatggcggctggataagctatgtcatgacc
actgctggccccgaaccactggaaacccggcaatcccccatcgattacgatcactacctg
acacgtcagctacagcctgtggcagacgctatacttcccttcatgcatgatgacttcaca
acactgataaccggtcagatggggttattttaa

DBGET integrated database retrieval system