KEGG   Yersinia enterocolitica WA: CH47_3217Help
Entry
CH47_3217         CDS       T03643                                 

Gene name
fadB
Definition
(GenBank) fatty oxidation complex, alpha subunit FadB
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
yew  Yersinia enterocolitica WA
Pathway
yew00071  Fatty acid degradation
yew00280  Valine, leucine and isoleucine degradation
yew00281  Geraniol degradation
yew00310  Lysine degradation
yew00362  Benzoate degradation
yew00380  Tryptophan metabolism
yew00410  beta-Alanine metabolism
yew00640  Propanoate metabolism
yew00650  Butanoate metabolism
yew00903  Limonene and pinene degradation
yew00930  Caprolactam degradation
yew01100  Metabolic pathways
yew01110  Biosynthesis of secondary metabolites
yew01120  Microbial metabolism in diverse environments
yew01130  Biosynthesis of antibiotics
yew01200  Carbon metabolism
yew01212  Fatty acid metabolism
Module
yew_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:yew00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CH47_3217 (fadB)
   00650 Butanoate metabolism
    CH47_3217 (fadB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CH47_3217 (fadB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CH47_3217 (fadB)
   00310 Lysine degradation
    CH47_3217 (fadB)
   00380 Tryptophan metabolism
    CH47_3217 (fadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CH47_3217 (fadB)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CH47_3217 (fadB)
   00281 Geraniol degradation
    CH47_3217 (fadB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CH47_3217 (fadB)
   00930 Caprolactam degradation
    CH47_3217 (fadB)
Enzymes [BR:yew01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     CH47_3217 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CH47_3217 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     CH47_3217 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     CH47_3217 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: AJI84344
UniProt: A0A0T9SG50
LinkDB All DBs
Position
3496514..3498703
Genome map
AA seq 729 aa AA seqDB search
MLYQSETLQLHWLENGIAELVFDAPGSVNKLDTQTVANLGEALVVLEKQSELKGLLLRSA
KAAFIVGADITEFLSLFNEPPEKLHQWLVFANDIFNRLEDLPVPTIAAINGYALGGGCEC
ILATDFRVASPEARIGLPETKLGIMPGFGGSVRLPRLLGADSALEIIAAGKDIIAKDALK
VGLVDAVVAPEKLVDAALSMLKQAIDGKLDWQAARRPKLGPLKLNPTEAAMCFTIAKGMV
MQVAGKHYPAPLTAVKTIEAAAKFGRAEALILETNSFVPLAGSNEARALVGIFLNDQYVK
GQAKKLSKGVSAPKQAAVLGAGIMGGGIAYQSALKGVPVIMKDINDKSLTLGMNEAAKLL
NKQLERGKIDGLKMANILATIQPTLDYVGIERAQVIVEAVVENPKVKAAVLAEVETLIGE
ETVLASNTSTIPIDQLAKSLKRPENFCGMHFFNPVHRMPLVEIIRGTKTSDKTIAAVVAY
ATQMGKTPIVVNDCPGFFVNRVLFPYLAGFGMLVRDGADFRQIDKVMEKQFGWPMGPAYL
LDVVGIDTAHHAQAVMAVGFPERMNKDYRDAVDVMFDNQRFGQKNGQGFYRYTQDTKGKP
RKENDEQVDALLAQVSQPLQKFSDDDIIARTMIPMINEVVRCLEEGIIASPAEGDMALVY
GLGFPPFHGGVFRYLDTIGSANYVEMAQRYTHLGPLYQVPPGLRAKAEHNESYYPVAAAL
LDVSISQPA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgctctaccaaagcgaaacactacagcttcactggctggaaaacggcattgccgagttg
gtgtttgatgcaccaggttcagttaataagctggatacccaaactgtagccaatctgggc
gaagccttggttgtgttagaaaaacaaagtgagctcaaagggttgctattacgctcagcc
aaagcagcctttattgtcggtgccgatatcaccgagtttctatccctgtttaacgagccg
ccagaaaagttgcatcaatggttggttttcgccaacgatattttcaatcgtttggaagac
ttaccggtgccaaccattgcagcaatcaatgggtatgcgctgggtggcgggtgtgaatgt
atcttagccactgattttcgcgtggcctcgccagaagcacgtatcggtctaccggaaacc
aaactcggtatcatgccgggcttcggcggttcagttcgtttgccacggttattaggcgca
gacagtgcgctggaaattattgcggctggcaaagacattattgccaaagatgccttaaaa
gttgggctggttgacgccgttgtcgcccccgaaaagttggtcgatgccgcgttaagtatg
ttgaaacaagcgattgacggaaaactcgactggcaagctgcacgtcgtccgaaattaggg
ccactgaagctcaatccgaccgaagccgcgatgtgctttaccattgccaaaggcatggtc
atgcaagtcgccggtaaacactatccggcgcccttgactgccgtcaaaactattgaggcc
gctgcaaaatttggccgcgctgaagcattgatactggaaaccaatagttttgttccctta
gctggttccaatgaagcgcgtgcattagtcggtattttcttgaatgaccaatatgttaaa
ggtcaggctaaaaagctgtccaaaggtgtcagcgcccccaaacaggccgcagtgctgggt
gcagggattatgggcggtgggattgcctatcagtcggcactgaaaggtgtgccggtcatt
atgaaagatattaatgacaaatccctcacattagggatgaatgaagcggccaagttgctg
aataagcagttggagcgcggcaagatagatggcctgaaaatggcaaatatcttagcaacc
atccaaccaacattagattatgtcggcattgaacgcgcccaagtcatcgtggaagcggtg
gtagaaaatccaaaagtcaaagcggcggttctggcagaggttgaaacgcttatcggcgaa
gaaactgttctggcttctaacacttctacaattccgattgatcagctcgccaaatccctg
aaacgcccagaaaacttctgtggcatgcatttcttcaatccagtacaccggatgccgttg
gttgaaattattcgtggcaccaaaacttcagataagactatcgctgcagttgtggcatac
gccacgcaaatgggtaaaaccccgattgtagtcaatgattgcccaggcttctttgttaac
cgtgttttattcccgtatctggctggattcggcatgttagtccgagacggtgcggacttc
cgccaaattgataaagtgatggaaaagcaatttggctggccaatgggccctgcttatcta
ttagatgtggtgggcattgataccgcgcaccatgcacaggccgtgatggccgttggtttc
cctgagcgcatgaataaagattatcgcgatgcggttgacgtgatgtttgataaccaacgg
tttggtcaaaagaatggccaaggcttctaccgctatacccaagataccaaaggcaaaccg
cgtaaagagaatgatgaacaagtagacgcgttactggcgcaagtcagccagccgcttcag
aaatttagcgatgacgatattatcgcccgtaccatgatcccgatgatcaatgaggtggtg
cgatgtctggaagaaggcattattgccagcccggctgaaggtgatatggcgttggtatat
ggccttggattccctccattccacggcggcgtcttccgttaccttgataccatcggcagt
gcaaattatgtcgaaatggctcaacgctacacccatcttgggccgttgtatcaagtcccg
ccgggattgagagccaaagccgaacataacgaaagctattatcctgtggcagcagcgctg
cttgatgtttctatcagtcaaccggcatga

DBGET integrated database retrieval system