KEGG   Yersinia enterocolitica WA: CH47_3724Help
Entry
CH47_3724         CDS       T03643                                 

Gene name
glpD
Definition
(GenBank) aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
yew  Yersinia enterocolitica WA
Pathway
yew00564  Glycerophospholipid metabolism
yew01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:yew00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CH47_3724 (glpD)
Enzymes [BR:yew01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     CH47_3724 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 Pyr_redox_2 NAD_binding_8 3HCDH_N FAD_oxidored Lycopene_cycl GIDA HI0933_like
Motif
Other DBs
NCBI-ProteinID: AJI84400
UniProt: A0A0H5ICN7
LinkDB All DBs
Position
complement(4080259..4081773)
Genome map
AA seq 504 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLLLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKLAPHIAFPMRFRLPHQPHLRPAWMIRTGLFLYDHLGKRTSLPAS
KGLRFGPESVLKPELVRGFEYSDCWVDDARLVVLNAQEVVERGGEVRTRTKVTRAWREQG
LWMVEAVDANTGKTFTWRAKGLVNATGPWVKQFFDDGLKLKSPYGIRLIKGSHIVVPRVH
NQPQAYILQNEDHRIVFVIPWLDEYSIIGTTDVEYHGDPKDVKIDDQEIDYLLKVYNDHF
KKQLGRDDIVWTYSGVRPLCDDESDSPQAVTRDYTLDVADEGGKAPLLSVFGGKLTTYRK
LAEHALEKLSGYYPNVGPAWTKTGSLPGGDIGGSRDNYTVQLRHRYNWLPEGLARRYTRT
YGSHSELILADATSIESLGEHFGHGLYEAELRYLVEKEWVVELDDAIWRRTKLGMTLDDV
QKQRVAEWLAQVQAEKQQTLSLVS
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaaagacttgatcgtgatcggtggcggcattaatggtgccggtatcgctgcg
gacgctgcagggcgtggcctgtccgttctgctgctggaagcacaagatttggcctgtgct
acgtcttctgccagctccaaacttatccacggtggtttacgttacctggaacactatgaa
ttccggttggtcagtgaagcattggccgaacgtgaggttttgctgaaactggctcctcat
atcgctttcccaatgcgctttcgcctgccccatcagccccatctgcgcccggcgtggatg
attcgtaccggcttattcttgtacgatcatttgggcaaacgtaccagcctgcccgccagt
aaagggctacgctttggacccgaatcagtattgaagcccgagttagtgcgcggtttcgaa
tattctgactgctgggtcgatgatgcccgcctggtagtgctgaatgctcaggaagtggtc
gaacgtggcggcgaagtacgtactcgcaccaaagtgactcgcgcctggcgtgaacaaggc
ctatggatggtggaagcggtcgatgccaacaccggcaaaacctttacctggcgcgccaaa
gggttagtcaatgctaccggcccgtgggttaaacagttctttgatgatggtctgaaactg
aaatcaccttatggtatccgcctgatcaaaggtagccatattgtggtgccacgggttcat
aaccaaccacaagcctatattctgcaaaacgaagaccaccgtattgtcttcgtcattcct
tggttggatgaatattccatcatcggtaccactgatgtggaataccacggcgatccgaaa
gatgtgaagatcgacgatcaggaaattgattacctgctgaaggtctataacgaccacttt
aaaaagcaactgggccgcgacgatatcgtctggacttactctggcgttcgtccgctgtgt
gatgatgaatcagattcaccgcaagcggttacccgtgattacacactggatgtcgccgat
gaaggcggcaaagcaccactgctatcagtatttggtggcaaactgaccacttaccgcaag
ctggcagaacatgcactggaaaaactgtccggctactatccaaatgtcggcccagcatgg
acgaaaaccggctcgttaccgggcggggatattggtggcagccgtgataactataccgtg
caattacgccatcgctataactggctacctgaagggctggcgcgccgctatacccgtacc
tatggcagtcatagcgagctgattttggctgatgccaccagcatcgaaagcttgggcgaa
cacttcggccacggtctatatgaagcagaattgcgctatctggttgaaaaagagtgggtg
gttgaacttgatgatgcaatctggcgtcgcactaagttaggcatgactctggatgatgtg
cagaaacagcgagtggctgaatggctggcgcaagtacaagctgagaaacaacagaccctg
tctttggtctcctga

DBGET integrated database retrieval system