KEGG   Yersinia enterocolitica WA: CH47_4108Help
Entry
CH47_4108         CDS       T03643                                 

Gene name
glsA
Definition
(GenBank) glutaminase A
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
yew  Yersinia enterocolitica WA
Pathway
yew00220  Arginine biosynthesis
yew00250  Alanine, aspartate and glutamate metabolism
yew00471  D-Glutamine and D-glutamate metabolism
yew01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yew00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CH47_4108 (glsA)
   00220 Arginine biosynthesis
    CH47_4108 (glsA)
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    CH47_4108 (glsA)
Enzymes [BR:yew01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     CH47_4108 (glsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: AJI83948
UniProt: A0A0T9SEK1
LinkDB All DBs
Position
4453514..4454455
Genome map
AA seq 313 aa AA seqDB search
MTIDLARLNHVVKDSYSQYSTLAGGANASYIPYLASVPSQLAGLAIVTIDGDIISQGDTD
FRFALESISKVCSLALALEDIGPQAVQDKIGADPTGLPFNSVIALELHNGKPLSPLVNAG
AMSTVSAIKASNREERWARILDMQQQLVGAPIALSDEVNHSEQTTNFHNRAIAWLLYSAQ
AMYCDPMEACDVYTRQCSTLLNTIELATMGATFAAAGVNPVTKKQVLTASNTPFILAEMT
MEGMYGSSGDWAYTVGLPGKSGVGGGILAVVPGVMGIAAFSPPLDPVGNSVRGQKMVASV
AQQLGYNLYKGSL
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgactattgacctagctcgcttgaatcacgttgttaaggatagttattcacaatattcc
accctcgccggaggggcgaatgccagctacattccttatctggccagtgttcccagtcag
cttgctgggttggccattgtcacgattgatggcgatattatttcgcaaggtgataccgat
tttcgttttgccttggaatctatttcgaaagtgtgctctcttgccttagcgctagaagat
attggcccgcaagctgtgcaagacaagataggcgcagatcctaccggtttaccttttaac
tcggtcattgcgttggagctgcacaatggtaagccattgtcgccattggtaaatgcagga
gcgatgtcgacagtaagtgcgattaaggccagtaatagagaagagcgctgggcacggatt
ctggacatgcaacagcaactggttggtgccccgattgcactttcggatgaagttaaccat
tcagaacaaaccaccaattttcacaatcgcgccattgcatggctgctttattcggctcag
gccatgtattgcgacccgatggaggcttgtgacgtatacacacgtcagtgttcaacattg
ctcaatactattgaactggccaccatgggggcaacctttgcggcggcgggagtcaaccct
gtgactaaaaagcaggtgctgacggccagcaatacgccatttattttggctgaaatgacc
atggaagggatgtatggcagctctggagattgggcatataccgtgggtttaccgggtaaa
agtggtgtcggtggtgggatcctggcggtagtgcccggtgtcatggggattgcggcattt
tcgccgccccttgacccggtaggcaatagtgtacgcggccaaaaaatggtggcatcagtg
gcgcaacagttgggatataacctatataaaggttcgctttaa

DBGET integrated database retrieval system