KEGG   Yersinia enterocolitica subsp. palearctica Y11 (serotype 0 3): Y11_11031Help
Entry
Y11_11031         CDS       T02010                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11 (serotype:0:3)
Pathway
yey00240  Pyrimidine metabolism
yey01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yey00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    Y11_11031
Enzymes [BR:yey01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     Y11_11031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22
Motif
Other DBs
NCBI-ProteinID: CBY27078
UniProt: A0A0H3NRA4
LinkDB All DBs
Position
complement(1129238..1129837)
Genome map
AA seq 199 aa AA seqDB search
MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTLVFTAEIDNRFGVGTVSSRIGLSSQAL
LYNSGTSLLSIITTEHQKKPVHCILLDECQFLTKDQVQELCQVVDELHIPVLCYGLRTDF
LGELFPGSKYLLSWADKLVELKTICHCGRKANMVLRLDAQGRAVHDGEQVVIGGNESYVS
VCRRHYKEAIKAACLQQYP
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggctcaactttatttttattattcagcaatgaatgcaggcaaatccaccgcgctattg
cagtcttcttataactaccaagagcgtggcatgcgcacgctggtttttaccgcggagatt
gataatcgctttggggtcggaacggtcagttcgcgtattggcctgtcttcacaagccctg
ctttacaatagcggcacatcattattatctattatcaccacagagcatcagaagaaacct
gttcattgtattttacttgatgagtgtcagtttctgaccaaagatcaggttcaggaattg
tgccaggtagtagatgaattacatatccctgtgttgtgttacggcctgcgcactgatttc
ctcggtgagttattccccgggagtaaatacttgttgtcatgggccgacaaattagtcgaa
ttaaagacgatttgtcattgtgggcgcaaagcaaacatggtgttacgtttggatgcacag
gggcgagcagtgcacgatggtgaacaagtcgtcattggggggaatgaaagctacgtttcg
gtttgtcgccgccattataaagaagctattaaagcggcttgtctccagcaatatccttaa

DBGET integrated database retrieval system