KEGG   Yersinia enterocolitica subsp. palearctica Y11 (serotype 0 3): Y11_18611Help
Entry
Y11_18611         CDS       T02010                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11 (serotype:0:3)
Pathway
yey00020  Citrate cycle (TCA cycle)
yey00190  Oxidative phosphorylation
yey00650  Butanoate metabolism
yey01100  Metabolic pathways
yey01110  Biosynthesis of secondary metabolites
yey01120  Microbial metabolism in diverse environments
yey01130  Biosynthesis of antibiotics
yey01200  Carbon metabolism
Module
yey_M00009  Citrate cycle (TCA cycle, Krebs cycle)
yey_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
yey_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:yey00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Y11_18611
   00650 Butanoate metabolism
    Y11_18611
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Y11_18611
Enzymes [BR:yey01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Y11_18611
    1.3.5.4  fumarate reductase (quinol)
     Y11_18611
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_18 Fer4_9 Fer4
Motif
Other DBs
NCBI-ProteinID: CBY26320
UniProt: A0A0H3NMJ7
LinkDB All DBs
Position
complement(1869057..1869773)
Genome map
AA seq 238 aa AA seqDB search
MKLEFSIYRYNPDVDNAPHMQDYTLEAEEGRDMMLLDALIQLKEKDPTLSFRRSCREGVC
GSDGLNMNGKNGLACITPVSALQKGNKKIVIRPLPGLPVVRDLVVDMGQFYTQYEKIKPY
LLNDGKNPPAREHLQSPEQREKLDGLYECILCACCSTSCPSFWWNPDKFVGPAGLLAAYR
FLIDSRDTETTARLDDLDDAFSVFRCHSIMNCVSVCPKGLNPTKAIGHIKSMLLQRSA
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttgagttctcaatttatcgctataacccggacgtcgataacgcgccgcatatg
caggattacacgttagaagcggaagaaggccgggatatgatgttgctggatgcacttatc
cagttaaaagaaaaagatccgacgttgtcgtttcgccgctcatgccgtgaaggggtttgt
ggctccgacggtttgaatatgaatggcaaaaatgggttggcttgtattacgccagtttca
gctttgcaaaaaggcaataaaaagattgtgattcgcccattgccgggcttaccggtggtg
cgggatttagtggtcgatatggggcagttttatactcagtacgagaaaattaaaccatac
ctgttgaatgatggcaaaaatccgccagcacgtgagcatttgcaatcgccagaacaacgc
gagaaattggatggcctgtatgaatgcatcctatgtgcttgttgttccacatcttgcccg
tcattctggtggaatccggataaatttgtggggccagcagggttactggctgcctatcgc
ttcctgatagatagtcgtgatacggaaacaacagcacgtttggatgatctggacgacgct
tttagtgttttccgctgccatagcattatgaattgtgtcagtgtgtgtcctaaaggcctt
aacccgaccaaagcaatcggtcacattaagtctatgttgttgcagcgtagtgcatga

DBGET integrated database retrieval system