KEGG   Yersinia enterocolitica subsp. palearctica Y11 (serotype 0 3): Y11_18621Help
Entry
Y11_18621         CDS       T02010                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11 (serotype:0:3)
Pathway
yey00020  Citrate cycle (TCA cycle)
yey00190  Oxidative phosphorylation
yey00650  Butanoate metabolism
yey01100  Metabolic pathways
yey01110  Biosynthesis of secondary metabolites
yey01120  Microbial metabolism in diverse environments
yey01130  Biosynthesis of antibiotics
yey01200  Carbon metabolism
Module
yey_M00009  Citrate cycle (TCA cycle, Krebs cycle)
yey_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
yey_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:yey00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Y11_18621
   00650 Butanoate metabolism
    Y11_18621
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Y11_18621
Enzymes [BR:yey01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Y11_18621
    1.3.5.4  fumarate reductase (quinol)
     Y11_18621
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 FAD_binding_3 Thi4 HI0933_like FAD_oxidored Lycopene_cycl BEX
Motif
Other DBs
NCBI-ProteinID: CBY26319
UniProt: A0A0H3NST0
LinkDB All DBs
Position
complement(1869827..1871593)
Genome map
AA seq 588 aa AA seqDB search
MKLPVREFDAVVVGAGGAGMRAALQISQMGLSCALISKVFPTRSHTVSAQGGITVALGNT
HEDNWEWHMYDTVKGSDYIGDQDAIEYMCKTGPEAVLELEHMGLPFSRLEDGSIYQRPFG
GQSLNFGGEQAARTAAAADRTGHALLHTLYQQNLKNHTTIFSEWYALDLVKNQDGAFVGC
TAICIETGEVVYFKARATVLATGGAGRIYQSTTNAHINTGDGVGMALRAGVPVQDMEMWQ
FHPTGIAGAGVLVTEGCRGEGGYLLNKHGERFMERYAPNAKDLAGRDVVARSIMIEIREG
RGCDGPWGPHAKLKLDHLGKDVLESRLPGILELSRTFAHVDPIKEPIPVIPTCHYMMGGI
PTKVTGQAITVNEKGEDVVIPGLFAVGEIACVSVHGANRLGGNSLLDLVVFGRAAGMHLQ
ESLMEQGASRDASDSDIEASLDRMNRWNNTRSGEDPVEIRKALQSCMQHNFSVFREGDAM
AKGLEELRTIRERLQNARLDDTSGEFNTQRIECLELDNLMETAFSTAVSANFRTESRGAH
SRFDFPERDDANWLCHSLYLPGTESMTRREVNMQPKLRAAFPPKVRSY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgccggtcagagagtttgatgctgttgttgttggtgcgggtggcgcaggtatg
cgcgcggcactgcaaatttcacaaatggggctgtcttgcgccctgatatcaaaagtattc
ccaacccgttctcataccgtatctgctcagggtggtattactgtcgcactgggtaatacc
catgaagataactgggaatggcatatgtatgacacggtaaagggttccgattatatcggt
gaccaggatgccatcgaatatatgtgtaaaacaggccctgaagcggtgcttgaattggaa
cacatggggttaccgttctcccgcttagaagatggcagcatttatcagcggccattcggt
gggcagtcgctcaactttggcggtgagcaagcggcgcgtactgcggctgcggctgaccgt
accgggcatgcgctgttacacaccctttatcagcaaaacctgaaaaaccacaccactata
ttctctgagtggtatgcactggatttagtgaagaatcaggacggtgcttttgtgggctgt
acggctatttgcattgaaaccggtgaagtggtctatttcaaagcgcgggccaccgtgcta
gccaccggtggtgccggtcgtatttaccaatcaacaaccaatgcgcacattaataccggt
gacggtgttggcatggctttgcgtgccggtgtaccggtgcaggacatggaaatgtggcag
ttccacccgacgggtattgccggggcgggtgtgttggtcaccgagggctgccgtggtgaa
ggcggttacctgctgaataaacacggcgagcgctttatggaacgctatgcaccgaacgcc
aaagatttggccggtcgtgatgtggttgcgcgttctattatgattgaaatccgtgaaggc
cgtggttgcgatggcccttggggtccgcatgccaaactgaaattggatcacttgggtaaa
gatgtgctggaatcccgtctgccgggtattcttgagttatctcgtacctttgcacatgtt
gaccccattaaagaacctatcccggtgattccaacttgccattacatgatgggcgggatc
ccaaccaaggtgaccggtcaggccatcacagtaaatgaaaagggtgaagatgttgtcatc
cctggtctgtttgctgtgggtgaaattgcttgtgtttccgtccacggtgccaaccgtttg
ggggggaactcattgctggacttggtggtctttggtcgcgcagccggtatgcatctgcaa
gagtctttaatggaacaaggcgctagtcgcgatgccagtgattctgatattgaagcatca
ctggatcgaatgaaccgctggaataacacccgctcaggtgaagatccggttgagatccgt
aaagcattacaatcctgcatgcagcataacttctcggtattccgcgaaggtgatgcaatg
gctaaagggttagaagaactgagaactatccgcgaacgtctgcaaaatgcccgtctggat
gacacttctggcgagtttaatacccagcgtattgaatgtctggaattggataacctgatg
gaaacagcgttttccactgccgtgtcagcaaacttccgtaccgaaagccgtggcgcacat
agccgcttcgatttcccggaacgtgatgatgccaactggttgtgccattcgctctatttg
cctggcactgaaagcatgacccgccgtgaggtaaacatgcaacctaagctacgcgcggca
ttcccaccgaaagtgcgttcttattaa

DBGET integrated database retrieval system