KEGG   Yersinia enterocolitica subsp. palearctica Y11 (serotype 0 3): Y11_22981Help
Entry
Y11_22981         CDS       T02010                                 

Definition
(GenBank) superoxide dismutase [Cu-Zn] precursor
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11 (serotype:0:3)
Brite
Enzymes [BR:yey01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Y11_22981
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: CBY25883
UniProt: A0A0H3NLA1
LinkDB All DBs
Position
complement(2346351..2346875)
Genome map
AA seq 174 aa AA seqDB search
MKLKYLLLPAMLFTGSVLAAGVTVTMNEALPDGNGKALGTVTVTETPYGLLFTPNLTGLV
AGIHGFHLHENPSCAPGLKEGKAVPALAAGGHFDPQKTGAHLGPYSDKGHLGDLPGLVVN
ADGTATYQVLAPRLKSLSEVKQHALMIHAGGDNYADHPMPLGGGGARMACGVIE
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgaaatacctactgttaccggcgatgcttttcactggcagtgtgctggctgcc
ggggttaccgtgaccatgaatgaagcgctgccagacggaaatggcaaagcgctgggcact
gttaccgtgacagaaaccccttatggtttgctgttcacgccaaatctgactgggttggtt
gcgggtattcatggtttccatctccatgagaatccaagttgtgcgccggggctcaaagag
ggtaaagctgtgcccgcattggctgcgggcggccatttcgatccgcaaaaaaccggggca
caccttgggccttatagtgataaagggcacttgggtgacttgccggggctggtggtcaat
gccgatggcactgctacctaccaagtattggctccgcgtctgaaatcgctatcagaggtg
aaacagcatgcgctaatgattcatgctggtggtgataactatgctgaccatcccatgcct
ttggggggcggcggtgcgcgaatggcttgtggtgtcattgagtaa

DBGET integrated database retrieval system