KEGG   Yersinia enterocolitica subsp. palearctica Y11 (serotype 0 3): Y11_27461Help
Entry
Y11_27461         CDS       T02010                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11 (serotype:0:3)
Pathway
yey00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:yey00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Y11_27461
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:yey02000]
    Y11_27461
Enzymes [BR:yey01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Y11_27461
Transporters [BR:yey02000]
 Other Transporters
  Pores ion channels [TC:1]
   Y11_27461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_N_4 GST_C_2
Motif
Other DBs
NCBI-ProteinID: CBY25435
UniProt: A0A0H3NM45
LinkDB All DBs
Position
complement(2785369..2786040)
Genome map
AA seq 223 aa AA seqDB search
MVIVHHLNNSRSQRILWMLEELQVPYELKRYQRDPGSLLAPPELKKVHPLGKSPVITDGD
LTLAESGAIIEYLQETYDAQGLFKPTGHYDRQQFRYWMHYAEGSLMPLLVMKLIFSRFGG
PPVPWIIRPVAKALGDGVQKNYLNKQIATHRAYLEQHLEKNQWFAGSDFSAADIQMSFPI
EAINMRGGLAGFPKLQDFLVRIHQRPAYQQAIEKGGAFKLENG
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atggtcattgttcaccatctgaataattcacgttcgcagcgtatcctgtggatgttggaa
gagttgcaagtcccctatgagttaaagcgttatcaacgtgatcctggcagcttgctggca
ccaccggagttgaaaaaagtccatcccttggggaaatcaccggtgattactgatggcgac
ctgacactggcggaatcgggtgccatcatcgagtatttgcaggaaacctatgatgcgcag
ggcttgtttaagcccaccggccattatgatcgccagcaatttcgttactggatgcattac
gcagaaggctccttgatgccattgctggtgatgaaacttatctttagccgcttcggtggg
ccacctgtgccgtggattattcgtccggttgccaaagccttgggtgatggggtgcagaaa
aattatctgaataagcaaattgccactcatcgcgcttatctggaacagcatctggaaaag
aatcaatggtttgctggcagcgattttagtgcggcagatattcagatgagttttcctatt
gaggcaataaatatgcgcggcggtcttgcggggttcccgaaactgcaagatttcttagtg
cgcattcatcagcgcccggcttatcaacaggcgattgaaaagggcggcgcgttcaaatta
gaaaacggataa

DBGET integrated database retrieval system