KEGG   Yersinia enterocolitica subsp. palearctica Y11 (serotype 0 3): Y11_28871Help
Entry
Y11_28871         CDS       T02010                                 

Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11 (serotype:0:3)
Pathway
yey00260  Glycine, serine and threonine metabolism
yey01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yey00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Y11_28871
Enzymes [BR:yey01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     Y11_28871
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 FAD_binding_3 AlaDh_PNT_C HI0933_like FAD_binding_2 Pyr_redox_3 T6SS_VipA FAD_oxidored UDPG_MGDP_dh_N Pyr_redox
Motif
Other DBs
NCBI-ProteinID: CBY25294
UniProt: A0A0H3NWW3
LinkDB All DBs
Position
complement(2956714..2957754)
Genome map
AA seq 346 aa AA seqDB search
MKASSMKALAKLKAEEGIWMTNVPQPELGHNDIMIKIRKTAICGTDVHIYNWDEWSQKTI
PVPMVVGHEYVGEVVAIGQEVKGFNIGDRVSGEGHITCGHCRNCRGGRTHLCRNTVGVGV
NRPGSFAEYLVIPAFNAFKIPDNISDELAAIFDPFGNAVHTALSFDLVGEDVLVSGAGPI
GIMAAAVCKHVGARHVVITDVNEYRLDLARKMGVTRAVNVNKENLNDVMAELGMTEGFDV
GLEMSGAPSAFRALLNSMNHGGRIAMLGIPPSDMSIDWNQVIFKGLFIKGIYGREMFETW
YKMAALIQSGLDLTPIITHRFSIDEFQQGFDAMRSGKSGKVILNWD
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcatcatctatgaaagcgctggccaaactgaaggcagaagaaggtatttggatg
actaacgtgccgcagccggagctgggtcacaacgacatcatgatcaaaattcgcaaaacg
gctatttgtggcactgatgtgcatatttataactgggatgagtggtcacaaaaaactatt
cctgttccgatggtcgtcggtcacgaatatgtcggtgaagttgtggctattggtcaggaa
gttaaaggttttaatattggtgaccgggtgtctggcgaaggtcatattacctgtgggcat
tgccgtaactgtcgcggcggtcgtacccatctttgccgcaatactgtgggtgtcggtgtg
aatcgtcctggttcttttgcagaatatctggtgattccggcctttaatgccttcaaaatt
cctgacaatatttctgatgaattagcggccatttttgaccccttcggtaatgcagtacac
accgcgttatcctttgatttagttggggaagacgtgcttgtttccggcgcaggcccgatt
ggtatcatggctgctgcggtgtgtaagcatgtcggcgctcgccatgtcgttatcactgat
gtgaatgagtaccgtctggatctggcgcggaaaatgggtgtgactcgcgcggttaacgtc
aacaaagaaaatctgaatgatgttatggcagaactggggatgactgaagggtttgatgtc
ggtttggaaatgtccggtgcgccgtcagcattccgtgcattgcttaattcaatgaatcac
ggtggccgtattgcgatgttggggataccgccatctgatatgtctatcgactggaatcag
gtgattttcaaggggctatttatcaaagggatttatggccgcgagatgtttgaaacctgg
tacaaaatggcagcattgattcaatctggtttggatttaaccccgattatcacccatcgt
ttctcgatcgatgaattccagcaaggctttgacgccatgcgttcgggtaagtcaggtaag
gtaatattaaactgggattaa

DBGET integrated database retrieval system