KEGG   Yersinia enterocolitica subsp. palearctica Y11 (serotype 0 3): Y11_36611Help
Entry
Y11_36611         CDS       T02010                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11 (serotype:0:3)
Pathway
yey00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:yey00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Y11_36611
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:yey01002]
    Y11_36611
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:yey01011]
    Y11_36611
Enzymes [BR:yey01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Y11_36611
   3.4.21  Serine endopeptidases
    3.4.21.-  
     Y11_36611
Peptidases [BR:yey01002]
 Serine Peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   Y11_36611
Peptidoglycan biosynthesis and degradation proteins [BR:yey01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   Y11_36611
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13 Beta-lactamase2 Transpeptidase
Motif
Other DBs
NCBI-ProteinID: CBY28869
UniProt: A0A0H3P0R4
LinkDB All DBs
Position
complement(3796788..3798236)
Genome map
AA seq 482 aa AA seqDB search
MHFSRIVSGLACAIAINISISNANAAQVENYTQYLPDGASLALVVQKIGATTPAIDYHAQ
QMALPASTQKVLTALAALLQLGPDFRFNTTLESHGTISDGILRGNLIARFDGDPTLTRQQ
LRNMVATLRKSGVKQIAGDLIIDTSVFASHDKAPGWPWNDMTQCFSAPPAAAIVDRNCFS
VSLYSAPNPGDMAFIRVASYYPVQMFSEVRTLAKGSPDAQYCELDVVPGELNRFTLTGCL
TQRSEPLPLAFAVQNGASYAGAILKDELKKADIQIDGSLRRQTTPNAAGTVLAQAQSAPL
HDLLKIMLKKSDNMIADTVFRTIGHQRFGVPGTWRAGADAVRQVLRQKAGVDLGNSIVVD
GSGLSRHNLISPATMMQALQYIAQHDQELNFISMLPLSGYDGTLRYRGGLHEAGVDGKVS
AKTGALQGVYNLAGFITTASGQRMAFVQFLSGYAVPPEDQKNRRAPLVRFESRLYKDIYQ
NN
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgcatttttcacgaattgtcagtggattggcctgtgctattgcgatcaatatcagcata
tctaatgccaatgcggctcaggttgagaattacacacaatatctgcctgatggggcaagt
cttgcgttagtcgtacaaaaaatcggggctactactccagcaatagactatcacgctcag
cagatggcattgcctgccagtacgcaaaaagtcctgactgcgctggcggcattattgcag
cttgggccagattttcgcttcaataccacattggaaagccacggcacgattagtgatggg
attttacgtggcaatttgatagcacgttttgatggcgaccccactttaacacgccagcaa
ttgcgtaatatggtggcaacattaagaaaatcgggcgtaaaacaaatcgccggtgatttg
attattgatacgtcggtgtttgccagccatgacaaagctccaggttggccgtggaacgac
atgacacagtgctttagtgcgccgcctgcggccgcgattgtcgatcgtaactgtttttct
gtctctctttatagcgcaccgaatccaggggacatggcatttatccgagtcgcatcttat
tacccggtgcagatgtttagtgaagttcgcaccttagccaaaggctcgcctgatgcgcaa
tattgcgaattagatgtagtgcctggtgaattaaaccgattcaccctgaccggctgcctg
acacagcgcagtgaaccgctacccttggcctttgcagtacaaaatggggccagctatgcc
ggtgctattttgaaagatgaattgaaaaaagctgacatccaaattgatggcagtttacgc
cgccagacgacacccaatgccgctggaaccgtgttagctcaagctcaatcagcgccgtta
catgacttgctgaaaatcatgttgaaaaaatctgacaacatgattgctgacaccgtattt
agaaccattggtcatcagcgttttggcgttccgggaacgtggcgcgccggtgctgatgcg
gtacgccaggtgttgcgacaaaaagcaggtgtggatctggggaacagtattgtggtggat
gggtcgggcttatcacgccataacctgatttcaccagcaaccatgatgcaggccttacag
tatatagctcagcatgatcaagaacttaactttatctcaatgctgccattatcaggctac
gacggcacattacgctatcgtggtgggttgcacgaagcaggtgttgacggcaaagtttca
gctaaaacaggcgcattacaaggcgtctacaatctggccggatttattactaccgccagt
gggcaacgcatggcttttgtgcaattcttgtcaggctacgctgtgccacctgaagatcaa
aaaaatcgccgcgcgccattggtgcgtttcgaaagccgactgtataaagacatttatcag
aacaactaa

DBGET integrated database retrieval system