KEGG   Yersinia enterocolitica subsp. palearctica Y11 (serotype 0 3): Y11_41181Help
Entry
Y11_41181         CDS       T02010                                 

Definition
(GenBank) acetyl-coenzyme A carboxyl transferase alpha chain
  KO
K01962  acetyl-CoA carboxylase carboxyl transferase subunit alpha [EC:6.4.1.2 2.1.3.15]
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11 (serotype:0:3)
Pathway
yey00061  Fatty acid biosynthesis
yey00620  Pyruvate metabolism
yey00640  Propanoate metabolism
yey01100  Metabolic pathways
yey01110  Biosynthesis of secondary metabolites
yey01120  Microbial metabolism in diverse environments
yey01130  Biosynthesis of antibiotics
yey01200  Carbon metabolism
yey01212  Fatty acid metabolism
Module
yey_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:yey00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Y11_41181
   00640 Propanoate metabolism
    Y11_41181
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Y11_41181
Enzymes [BR:yey01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     Y11_41181
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     Y11_41181
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACCA Carboxyl_trans MdcE Med9
Motif
Other DBs
NCBI-ProteinID: CBY28412
UniProt: A0A0H3NTU0
LinkDB All DBs
Position
4310986..4311945
Genome map
AA seq 319 aa AA seqDB search
MSLNFLDFEQPIAELEAKIDSLTAVSRQDEKLDINLDEEVQRLREKSVELTRKIFSDLGA
WQIAQLARHPRRPYTLDYIANIFTDFEELAGDRAYADDKAIVGGIARLDGRPVMIIGHQK
GRETKEKIRRNFGMPAPEGYRKALRLMEMAERFKLPIITFIDTPGAYPGVGAEERGQSEA
IARNLREMSRLNVPIVCTVIGEGGSGGALAIGVGDKVNMLQYSTYSVISPEGCASILWKS
ADKAPLAAEAMGITAHRLKELKMIDSVIPEPLGGAHRDYLAIAASLKAQLLADLSDLDVL
NDEELLNRRYQRLMNYGYC
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgaattttcttgattttgaacagccgattgcagagctggaagcgaaaattgac
tcgctgaccgcagtcagccgtcaagacgaaaaattagatattaatctggacgaagaggtt
cagcgtctacgtgagaaaagtgtcgagctgacgcggaagatattctcggatctcggtgca
tggcagattgcccaattggcacgccatcctcgtcgcccttataccctggattatatcgct
aatatctttactgatttcgaagagctggcaggtgatcgcgcctatgctgacgataaagct
atcgtcggtggtatcgctcgcctggatggtcgcccggtgatgatcattggtcatcaaaaa
ggtcgtgaaaccaaagagaagattcgccgtaactttggtatgccagcgccagaaggttat
cgtaaggcattgcgtctaatggaaatggctgagcgctttaagctgccaattattactttc
attgataccccaggggcttatcctggtgttggtgctgaagaacgtggtcaatctgaggcc
attgcgcgtaacttgcgtgagatgtctcgcctgaatgtgcctatcgtttgtactgtcatt
ggcgaaggtggttctggcggtgccttggcaatcggtgtaggcgataaagtgaatatgctg
caatacagcacttattccgttatctcgccagaaggctgtgcctctattttgtggaaaagt
gctgataaagcgcctctagccgcagaagcaatgggtattactgctcatcgtttgaaagaa
ctgaagatgatcgactctgtcattcctgagcctttgggcggtgcgcatcgtgattatctg
gcgattgccgcttcactgaaagcacagcttctggctgatctcagtgatctggatgtgttg
aatgatgaagagttattaaatcgtcgttatcagcgcctgatgaactatggttattgctga

DBGET integrated database retrieval system