KEGG   Yersinia enterocolitica subsp. palearctica Y11 (serotype 0 3): Y11_42681Help
Entry
Y11_42681         CDS       T02010                                 

Definition
(GenBank) inositol-1-monophosphatase
  KO
K01092  myo-inositol-1(or 4)-monophosphatase [EC:3.1.3.25]
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11 (serotype:0:3)
Pathway
yey00521  Streptomycin biosynthesis
yey00562  Inositol phosphate metabolism
yey01100  Metabolic pathways
yey01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:yey00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Y11_42681
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Y11_42681
Enzymes [BR:yey01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.25  inositol-phosphate phosphatase
     Y11_42681
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Inositol_P FBPase_glpX
Motif
Other DBs
NCBI-ProteinID: CBY28262
UniProt: A0A0H3NXM7
LinkDB All DBs
Position
complement(4456847..4457653)
Genome map
AA seq 268 aa AA seqDB search
MHPMLTIAIRAARKAGNLIAKHYETPDSVEASQKGSNDFVTNVDRDAESMIVDVIRKSYP
KHTIIGEECGELVGEDYDVQWVIDPLDGTTNFIKRLPHFAVSIAVRIKGRTEVAVVYDPM
RNELFTATRGQGAQLNGYRLRGTNAKDLDGTILATGFPFKVKQHAPAYIRIVGKLFEQCA
DFRRTGSAALDLAYVAAGRVDGFFEIGLKPWDFAGGELLVRESGGVVTDFVGGHNHFSSG
NIVAGNPRVVKGILQSIVQAEVSDALKR
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgcatccaatgctgactatcgccatacgcgctgcgcgtaaggccggtaacctgattgcc
aaacattatgaaacgcctgactccgtcgaagcgagccaaaaaggcagtaacgattttgtt
accaacgttgaccgcgatgccgagtctatgattgttgacgttatccgtaaatcttaccca
aaacacaccattattggtgaagaatgcggtgagttggtcggcgaagattatgatgtacaa
tgggttattgatccactggatggcactaccaacttcattaaacgtcttcctcatttcgct
gtttctatcgccgtacgcatcaaaggccgtactgaagttgccgtagtttatgacccaatg
cgtaacgaactgtttacagctactcgtggtcaaggcgctcaattaaatggttatcgcctg
cgtggcaccaatgccaaagatttagacggcaccattctggcaactggcttcccattcaaa
gttaaacaacatgctccggcgtatatccgtattgttggcaaactgtttgaacagtgcgca
gattttcgccgcaccggttctgcggcactggatttggcctatgttgccgccggccgtgtt
gacggtttctttgaaattggcctgaagccgtgggattttgctggcggcgaactgttagtt
cgtgagtcaggtggtgtggtaactgactttgtcggtggtcataatcacttcagctctggc
aatatcgtggccggtaatccgcgcgttgttaaaggcattcttcagtccatagttcaggcc
gaagtgagtgatgcactgaaacgttaa

DBGET integrated database retrieval system