KEGG   Yersinia frederiksenii: AW19_1338Help
Entry
AW19_1338         CDS       T03606                                 

Gene name
gst
Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
yfr  Yersinia frederiksenii
Pathway
yfr00480  Glutathione metabolism
yfr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yfr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AW19_1338 (gst)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:yfr02000]
    AW19_1338 (gst)
Enzymes [BR:yfr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AW19_1338 (gst)
Transporters [BR:yfr02000]
 Other transporters
  Pores ion channels [TC:1]
   AW19_1338 (gst)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N GST_N_2 GST_N_3 GST_C_3 GST_C_2 GST_C_6
Motif
Other DBs
NCBI-ProteinID: AJI85537
UniProt: A0A0B6FM33
LinkDB All DBs
Position
1445050..1445652
Genome map
AA seq 200 aa AA seqDB search
MKLFYKPGACSLSPHIVLREAGLDFSIESVDLATKKTETGEDYLRINPKGQVPALLLDDG
SLLTEGVAIVQYLADIVPDRQLIAPSGTLSRYHAIEWLNFVATELHKGFSPLFNPKTPDE
YKAIARERLDKQFSYVDSELAKHDYLLGSKFSVADAYLFTVTRWANALKLDIKQRSHLDK
YMARVAGRPAVKEALAAEKI
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgttctataaacccggtgcctgttctttgtccccccatattgtattacgtgaa
gcggggctagatttcagtattgaaagcgtcgatctggcgactaaaaaaactgaaacgggt
gaagactatttgcgcatcaatccaaaaggacaagttcctgctctgttactggatgacgga
agcctactcaccgaaggtgtggctatcgtgcaatatctggcagacatcgtgcccgatcgt
cagctaattgcaccatcaggcaccctttctcgctatcacgccattgagtggttaaatttc
gtggcgactgaattacataaaggcttcagcccactgtttaacccgaaaacacccgatgaa
tataaagcgattgctcgtgagcggctggataaacaattcagctacgtcgatagcgaatta
gcaaaacatgattatctgttaggctcaaaattcagtgtagccgacgcctatctatttacg
gtcacccgttgggcgaatgcactgaagcttgatattaagcagcgcagccatttagacaaa
tatatggcgcgggtagctggccgcccggcagtaaaagaagccttggcagcagaaaagata
taa

DBGET integrated database retrieval system