KEGG   Yersinia frederiksenii: AW19_2696Help
Entry
AW19_2696         CDS       T03606                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
yfr  Yersinia frederiksenii
Pathway
yfr00250  Alanine, aspartate and glutamate metabolism
yfr00410  beta-Alanine metabolism
yfr00430  Taurine and hypotaurine metabolism
yfr00650  Butanoate metabolism
yfr01100  Metabolic pathways
yfr01110  Biosynthesis of secondary metabolites
yfr01120  Microbial metabolism in diverse environments
yfr02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:yfr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AW19_2696
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AW19_2696
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AW19_2696
   00430 Taurine and hypotaurine metabolism
    AW19_2696
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AW19_2696
Enzymes [BR:yfr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     AW19_2696
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AJI88044
UniProt: A0A0B6FKD4
LinkDB All DBs
Position
complement(2923351..2924751)
Genome map
AA seq 466 aa AA seqDB search
MTKKSLDDYRSTLLDSRFGSQAIRHISENKNFPKEEMREDIAFQIISDELFLDGNARQNL
ATFCQTWDDDNVHKLMDLSINKNWIDKEEYPQSAAIDMRCVNMMADLWNAPTPKGEQGVG
TNTIGSSEACMLGGMAMKWRWRKKREAAGKPTNKPNFVCGPVQVCWHKFARYWDVEIREI
PMVPGQLFMDPQRMIEACDENTIGVVPTFGVTYTGNYEFPKPLHDALDKLQKDTGLDIDM
HIDAASGGFLAPFVAPDIEWDFRLPRVKSISTSGHKFGLAPLGCGWVIWRDAAALPEELI
FNVDYLGGQVGTFAINFSRPAGQVISQYYEFIRLGREGYTKVQSACYQVAEFLAKEIAPL
GPYEFYCSGGPDEGIPAICFRIKEGAKTGYTLYDLSERLRLRGWQVPAFTLSGKMSDVVV
MRIMCRRGFEMDFAGLLLDDFKSSLKYLSEHPSLGGLASQNSFNHT
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaaaatctctggatgattatcgctctacgttattagattcccgctttggctct
caagccattcgtcatatttcagaaaataaaaattttcctaaagaggagatgcgcgaggat
attgcttttcaaatcataagtgacgagctatttcttgatggtaatgcgcgacagaatctc
gcgacattttgccaaacgtgggacgacgataatgtccacaagttaatggacctttcgata
aataaaaactggattgataaagaggaatatccgcaatcggcggcaatagatatgcgttgt
gtaaacatgatggccgatttgtggaatgcacctacgccaaaaggtgagcaaggggtgggg
acgaataccattggttcttcagaagcttgcatgctgggtggcatggcgatgaagtggcgc
tggcgcaaaaaaagagaagcggcaggtaaacccacgaataagcctaattttgtctgtggg
ccggtacaagtttgttggcataaatttgctcgttattgggatgtcgaaatacgtgaaatt
cctatggttccagggcaattatttatggacccacagcggatgatagaggcatgcgacgaa
aatactattggcgtagtgccgactttcggtgtgacttacacaggtaactatgagtttcct
aaacccttgcatgatgcgctggataagctacaaaaagatactggccttgatattgatatg
catatcgatgcggcgagtggtggctttttagcgccctttgttgcgccggatattgagtgg
gatttccgtttgccacgggtgaaatcaatcagcacttccgggcataaattcggattggca
cctttgggatgtggttgggttatttggcgtgatgcggcagccttacctgaagagcttata
tttaatgtcgattatcttggcggtcaggtcggcacttttgctatcaatttctcgcgcccc
gcagggcaagttatttcccaatattatgaattcatacgcttagggcgtgaaggttatacc
aaggtacaaagtgcctgttatcaggtggcagaattcctagctaaagaaattgcaccactt
gggccttatgagttctattgcagtggtggcccggatgagggtattcccgccatctgtttc
cgtattaaagagggggcaaaaacgggatataccttatatgacctttccgagcgtttgagg
ctacgtggttggcaagttccggcatttaccttgagtggaaagatgtctgatgttgtggtc
atgcgtattatgtgccgccgcggattcgaaatggatttcgccgggctgttattagacgat
tttaaatcttcactgaaatacctaagtgaacatccatcccttgggggcctggcaagtcag
aatagttttaatcatacataa

DBGET integrated database retrieval system