KEGG   Yersinia frederiksenii: AW19_3328Help
Entry
AW19_3328         CDS       T03606                                 

Gene name
sodA
Definition
(GenBank) superoxide dismutase Mn
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
yfr  Yersinia frederiksenii
Brite
Enzymes [BR:yfr01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AW19_3328 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N HTH_54
Motif
Other DBs
NCBI-ProteinID: AJI86585
UniProt: A0A0B6FLN4
LinkDB All DBs
Position
complement(3604198..3604821)
Genome map
AA seq 207 aa AA seqDB search
MSYSLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANTVLESFPELAKFSVEDLIKD
LDKVPAEKRTFMRNNAGGHANHSFFWKGLKLGTTLTGDLKAAIERDFGSVDSFKEKFEQA
AATRFGSGWAWLVLKDDGKLAVVSTANQDSPLMGEAVSGASGFPIIGLDVWEHAYYLKFQ
NRRPDYIKAFWNVVNWDEAAARFAQAK
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgagttactcactgccatccctgccttatgcttacgatgctttagaaccccatttcgat
aagcagacgatggaaatccatcacaccaaacaccaccaaacctatgttaataatgcaaac
acggtgttggagagcttccctgagctggctaaattcagcgttgaagacctgatcaaagat
ctggacaaagtcccggcagaaaaacgcacctttatgcgtaataacgccggcggccacgct
aaccatagctttttctggaaaggcctgaaactgggcaccactctgaccggtgacctgaaa
gccgctatcgagcgcgacttcggcagcgttgacagcttcaaagaaaaatttgagcaagct
gcggcaacgcgtttcggttcaggttgggcttggctggttctgaaagatgatggcaaactg
gcggttgtttctactgctaaccaagacagtccgctgatgggcgaagctgtttctggcgca
tctggcttcccgattattggcctggatgtgtgggaacacgcttactacctgaaattccaa
aaccgccgcccagactacatcaaagcattctggaacgtcgttaactgggacgaagccgcc
gcgcgtttcgctcaagctaagtaa

DBGET integrated database retrieval system