KEGG   Yersinia frederiksenii: AW19_3484Help
Entry
AW19_3484         CDS       T03606                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase 1
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
yfr  Yersinia frederiksenii
Pathway
yfr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
yfr01100  Metabolic pathways
yfr01110  Biosynthesis of secondary metabolites
yfr01130  Biosynthesis of antibiotics
yfr01230  Biosynthesis of amino acids
Module
yfr_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:yfr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AW19_3484 (aroK)
Enzymes [BR:yfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     AW19_3484 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 Cytidylate_kin dNK Cytidylate_kin2 AAA AAA_16 AAA_22 TsaE APS_kinase ABC_tran AAA_25 AAA_5 AAA_7 Ploopntkinase3 AAA_17 AAA_24 RNA_helicase AAA_28 AAA_PrkA His_biosynth AAA_29 RsgA_GTPase AAA_14 MMR_HSR1 Mg_chelatase IstB_IS21 AAA_2
Motif
Other DBs
NCBI-ProteinID: AJI86303
UniProt: A0A0B6FAE7
LinkDB All DBs
Position
3797118..3797639
Genome map
AA seq 173 aa AA seqDB search
MAEKRNIFLVGPMGAGKSTIGRQLAQQLNMEFFDSDQEIERRTGADVGWVFDVEGEEGFR
DREEKVINELTEKQGIVLATGGGSVKSRETRNRLSARGVVVYLETTIEKQLARTQRDKKR
PLLQVDSPPREVLEALAKERNPLYEEIADVTIRTDDQSAKVVANQIINMLESN
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaaacgcaatatctttctggttgggcctatgggtgccggcaaaagcactatt
ggtcgtcagttagctcagcaactcaatatggagtttttcgactctgatcaagaaattgag
cgacgtaccggagctgacgtgggctgggtattcgacgtggaaggcgaagaaggtttccgc
gatcgtgaagaaaaagttattaatgaactgacggaaaaacagggcattgttctggcaacc
ggtggtggctctgttaaatccagagaaacccgtaaccgtttgtcagcccgtggcgtggtg
gtgtatttagaaaccaccatcgagaagcagttggcccgcacacagcgcgacaaaaaacgt
ccgttgttgcaggttgattcgcctccacgtgaggtgttagaagcactggcaaaagaacgt
aatccgttgtacgaagaaattgcagatgtcaccatccgcactgacgatcaaagcgcgaaa
gttgttgctaaccagattatcaacatgctggaaagtaactga

DBGET integrated database retrieval system