KEGG   Yersinia frederiksenii: AW19_4013Help
Entry
AW19_4013         CDS       T03606                                 

Gene name
ddlB
Definition
(GenBank) D-alanine--D-alanine ligase B
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
yfr  Yersinia frederiksenii
Pathway
yfr00473  D-Alanine metabolism
yfr00550  Peptidoglycan biosynthesis
yfr01100  Metabolic pathways
yfr01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:yfr00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    AW19_4013 (ddlB)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AW19_4013 (ddlB)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    AW19_4013 (ddlB)
Enzymes [BR:yfr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AW19_4013 (ddlB)
Peptidoglycan biosynthesis and degradation proteins [BR:yfr01011]
 Precursor biosynthesis
  Amino acid ligase
   AW19_4013 (ddlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATPgrasp_Ter ATPgrasp_ST RimK ATP-grasp ATPgrasp_YheCD TTL
Motif
Other DBs
NCBI-ProteinID: AJI87576
UniProt: A0A0B6FRU1
LinkDB All DBs
Position
4355804..4356724
Genome map
AA seq 306 aa AA seqDB search
MADKVAVLLGGTSAEREVSLLSGQAVLAGLREAGIDAHGVDTRDFPVTQLKEQGFNKVFI
ALHGRGGEDGTLQGVLEFLKLPYTGSGVMASALTMDKLRTKLVWQALGLPISPYVALNRQ
QFETLSSEELAACVAKLGLPLIVKPSHEGSSVGMSKVDWASELHAALVEAFRHDTDVLIE
KWLSGPEFTVAILGEDVLPSIRIQAPGVFYDYEAKYLSDETQYFCPSGLSVELEQQLAEL
ALQAYQALGCSGWGRVDVMQDSDGGFYLLEVNTSPGMTSHSLVPMAARQYGLSFSQLVAR
ILTLAD
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggctgataaagttgcggtactgctgggtggaacctctgctgaacgtgaagtttcattg
ctatcgggccaggcggttttagccggtttgagagaagccggtatcgacgcccatggggta
gataccagagacttcccggtcactcaattgaaagaacagggttttaataaggtctttatt
gctctgcatggccgtggtggcgaagacggtacattgcaaggtgtgttggagttcctgaaa
ctgccttataccggcagcggcgtgatggcttcggccctgaccatggacaaattgcgcacc
aaattggtgtggcaagccttaggtttgccaatttcgccttatgtggcgctgaaccgtcaa
cagtttgaaacactttcgtcagaggaattagcggcatgtgtcgctaagcttggtctgcct
ttaatcgttaaaccaagtcacgaaggctctagcgtgggcatgagtaaagttgactgggct
agcgaattgcatgctgctctggttgaagctttccgtcatgacaccgatgtgctgattgaa
aaatggttgagcggcccggaattcacggtcgctatccttggcgaggatgttttaccgtcc
atcaggattcaagcacccggtgtgttttatgattatgaagccaagtatctgtctgatgaa
acacagtatttctgcccaagcggtttaagtgttgagttagagcaacaattagcagaatta
gcattacaggcttatcaggcgctaggttgcagcggttggggccgggttgatgtcatgcaa
gacagcgacggcggtttttatctgctggaagtgaatacttcaccggggatgaccagccac
agtttagtgccaatggcagcccgccaatatgggttgagtttttcccagttggtggcccga
attctgacgttggctgactga

DBGET integrated database retrieval system