KEGG   Yersinia frederiksenii: AW19_513Help
Entry
AW19_513          CDS       T03606                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
yfr  Yersinia frederiksenii
Pathway
yfr00020  Citrate cycle (TCA cycle)
yfr00190  Oxidative phosphorylation
yfr00650  Butanoate metabolism
yfr01100  Metabolic pathways
yfr01110  Biosynthesis of secondary metabolites
yfr01120  Microbial metabolism in diverse environments
yfr01130  Biosynthesis of antibiotics
yfr01200  Carbon metabolism
Module
yfr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
yfr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
yfr_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:yfr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AW19_513 (sdhA)
   00650 Butanoate metabolism
    AW19_513 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AW19_513 (sdhA)
Enzymes [BR:yfr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AW19_513 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     AW19_513 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 FAD_binding_3 Thi4 HI0933_like FAD_oxidored Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AJI87822
UniProt: A0A0B6FTL2
LinkDB All DBs
Position
530499..532265
Genome map
AA seq 588 aa AA seqDB search
MKLPVREFDAVVVGAGGAGMRAALQISQMGLSCALISKVFPTRSHTVSAQGGITVALGNT
HEDNWEWHMYDTVKGSDYIGDQDAIEYMCKTGPEAVLELEHMGLPFSRLEDGSIYQRPFG
GQSLNFGGEQAARTAAAADRTGHALLHTLYQQNLKNHTTIFSEWYALDLVKNQDGAFVGC
TAICIETGEVVYFKARATVLATGGAGRIYQSTTNAHINTGDGVGMALRAGVPVQDMEMWQ
FHPTGIAGAGVLVTEGCRGEGGYLLNKHGERFMERYAPNAKDLAGRDVVARSIMIEIREG
RGCDGPWGPHAKLKLDHLGKDVLESRLPGILELSRTFAHVDPIKEPIPVIPTCHYMMGGI
PTKVTGQAITVNEKGEDVVIPGLFAVGEIACVSVHGANRLGGNSLLDLVVFGRAAGMHLQ
ESLMEQGASRDASDSDIEASLERMNRWNNTRSGEDPVEIRKALQACMQNNFSVFREGDAM
ANGLEELKTIRERLQNARLDDTSSEFNTQRIECLELDNLMETAFSTAVSANFRTESRGAH
SRFDFPERDDANWLCHSLYLPDTESMTRREVNMQPKLRAAFPPKVRSY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgccggtcagagagtttgatgctgttgttgttggtgcgggcggcgcaggtatg
cgcgcggcactgcaaatttcacaaatggggctgtcgtgcgccctgatatccaaagttttc
ccaacccgttcccataccgtatctgcgcaagggggtatcactgttgcgctgggtaatacc
catgaagataactgggaatggcatatgtatgacacggtaaagggttccgattatatcggt
gaccaggatgccattgagtatatgtgtaaaaccggccctgaagctgtccttgagctggaa
cacatggggctacctttctcccgtttagaagatggcagcatttatcagcggccatttggt
gggcagtcgctcaactttggcggtgagcaagcggcgcgtactgcggcggcggctgaccgt
accgggcatgcactgttacacaccctttatcagcaaaacctgaaaaatcacaccacgatt
ttctccgaatggtatgcactggatttagtgaagaatcaggacggcgcttttgtgggctgt
accgctatctgcattgaaaccggtgaagtggtctatttcaaagcgcgggcgactgtgctg
gcgaccggcggtgctggacgtatttaccagtcaaccaccaatgcgcacattaataccggt
gacggtgtgggcatggccctgcgtgccggtgttccggtgcaggacatggaaatgtggcaa
ttccacccgacgggtatcgccggggcgggtgtgttggtgaccgagggttgccgtggtgaa
ggcggttatctgctgaataaacacggcgagcgctttatggagcgttatgcgccaaacgcc
aaagatttggcgggtcgtgatgttgtcgcgcgctccattatgattgaaatccgtgaaggc
cgtggttgtgatggcccgtggggcccgcatgctaaattgaagttggatcacttgggtaaa
gatgtgctggaatcccgcctgccgggcattcttgagctatcacgcacctttgctcacgtt
gacccaattaaagaaccgatcccggttatcccaacttgtcattatatgatgggcggaatt
ccgaccaaagtaactggccaggccattacagttaatgaaaagggtgaagatgttgtcatc
ccaggtttgtttgctgtgggtgaaattgcctgtgtttccgtccacggtgcaaaccgtttg
ggaggtaactcattgctggacttggtggtatttggtcgcgcagccggtatgcatctgcaa
gagtctttgatggagcagggcgctagccgcgatgccagtgattctgatatcgaagcatca
ctggagcgcatgaaccgttggaataacacccgctcaggtgaagacccggttgagatccgc
aaagcattacaggcctgtatgcagaataacttctcggtgttccgtgaaggtgatgctatg
gccaatggtttggaagaactaaaaactatccgcgaacgtctgcaaaatgcccgtttggat
gacacctccagtgaattcaatacccagcgtattgaatgtctggaattggacaacctgatg
gaaaccgcgttttccactgccgtgtctgcaaacttccgtaccgaaagccgtggcgcgcat
agccgcttcgacttcccggaacgtgatgatgctaactggttgtgtcactcgctctatttg
ccagacaccgaaagcatgacccgccgtgaggtaaacatgcaacctaagctacgcgcggcc
ttcccgccgaaagtgcgttcttactaa

DBGET integrated database retrieval system