KEGG   Yersinia frederiksenii: AW19_514Help
Entry
AW19_514          CDS       T03606                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
yfr  Yersinia frederiksenii
Pathway
yfr00020  Citrate cycle (TCA cycle)
yfr00190  Oxidative phosphorylation
yfr00650  Butanoate metabolism
yfr01100  Metabolic pathways
yfr01110  Biosynthesis of secondary metabolites
yfr01120  Microbial metabolism in diverse environments
yfr01130  Biosynthesis of antibiotics
yfr01200  Carbon metabolism
Module
yfr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
yfr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
yfr_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:yfr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AW19_514 (sdhB)
   00650 Butanoate metabolism
    AW19_514 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AW19_514 (sdhB)
Enzymes [BR:yfr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AW19_514 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     AW19_514 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_18 Fer4_9 Fer4
Motif
Other DBs
NCBI-ProteinID: AJI87149
UniProt: A0A0B6FHV8
LinkDB All DBs
Position
532320..533036
Genome map
AA seq 238 aa AA seqDB search
MKLEFSIYRYNPDVDNAPHMQDYTLEAEEGRDMMLLDALIQLKEKDPTLSFRRSCREGVC
GSDGLNMNGKNGLACITPVSALQKGNKKIVIRPLPGLPVVRDLVVDMGQFYTQYEKIKPY
LLNDGKNPPAREHLQSPEQREKLDGLYECILCACCSTSCPSFWWNPDKFVGPAGLLAAYR
FLIDSRDTETTARLDDLDDAFSVFRCHSIMNCVSVCPKGLNPTKAIGHIKSMLLQRSA
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttgagttttcaatttatcgctataacccggacgtcgataacgcgccgcatatg
caggattataccctcgaagcggaagaaggccgggatatgatgttgctggatgcccttatc
cagttaaaagaaaaagatccgacgctgtcgtttcgtcgctcatgccgtgaaggtgtttgt
ggctcagacgggttgaatatgaatggcaaaaatgggctggcatgcattacaccggtttcg
gctttgcaaaaaggcaataaaaagattgtgattcgcccattaccggggttgccggtggtg
cgggatttagtggtcgatatggggcagttttatactcaatatgagaaaattaaaccttac
ctgttgaatgatggcaaaaatccgccagcacgtgagcatttacaatcgccggaacagcgc
gaaaaactggatggtttgtatgaatgtatcctgtgtgcctgttgctccacatcttgcccg
tcattttggtggaatccggataaatttgttggcccagcagggttactggctgcctatcgc
ttcctgatagatagccgtgatactgaaacaacagcacgtttggatgatctggacgacgct
tttagtgttttccgctgccatagcatcatgaattgtgtcagtgtttgtcctaaaggcctt
aacccgaccaaagcaattggtcacattaagtctatgttgttacagcgtagcgcatga

DBGET integrated database retrieval system