Yersinia hibernica: D5F51_06505 Help Entry D5F51_06505       CDS       T05961                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism yhi  Yersinia hibernica Pathway yhi01100   Metabolic pathways yhi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:yhi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     D5F51_06505   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     D5F51_06505 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 TerB DUF1896 TMEM210 DUF1493 Motif Other DBs NCBI-ProteinID:  QAX78236 UniProt:  A0A481QB74 LinkDB All DBs Position 1395233..1395469 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIVEQLGVKEDEVKNSASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDFINANQQ NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaatcatcgttgaacaactgggtgttaaagaa gacgaagtgaagaacagtgcttctttcgttgaagatcttggcgcggattctctggacacc gttgagctggtaatggctctggaagaagaatttgatactgagattccagacgaagaagca gaaaaaatcactactgttcaggcagctattgattttatcaacgctaaccagcagtaa

DBGET integrated database retrieval system