KEGG   Yersinia hibernica: D5F51_08725Help
Entry
D5F51_08725       CDS       T05961                                 

Definition
(GenBank) glutathione-dependent disulfide-bond oxidoreductase
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
yhi  Yersinia hibernica
Brite
KEGG Orthology (KO) [BR:yhi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    D5F51_08725
Enzymes [BR:yhi01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     D5F51_08725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_C_2 GST_C GST_N_2 GST_N_3 GST_C_3 Cuticle_2
Motif
Other DBs
NCBI-ProteinID: QAX78635
UniProt: A0A481QD61
LinkDB All DBs
Position
complement(1845580..1846431)
Genome map
AA seq 283 aa AA seqDB search
MKDSEYQPPKVWTENHASGGVWSKINRPTAGARYEATLPVGKHPLQLYSMGTPNGQKVTI
LLEELLALGETGAEYDAHLIRIGDGDQFSSGFVAVNPNSKIPALMDHSTTPPVRVFESGA
ILLYLADKFGHFLPRSVAGRTEALNWLFWLQGAAPYLGGGFGHFYHYAPVKIEYAIDRFA
MEAKRQLSLLDNQLATHEYIAGDEYSIADMAIWPWYGNLVLGLQYEAGEFLDVKSYTHLI
RWTEAIAKRPAVQRGRIVNKTWGEPAEQLAERHDAADFDRLIK
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacagtgaatatcagccaccgaaagtatggacagaaaaccacgccagcggcggt
gtctggtctaagatcaaccgcccgacggcgggcgcccgatatgaggctaccctgcccgtc
ggcaaacacccattgcagctctattccatggggacgccgaatggtcagaaggtcactatt
ttgctggaagagttgttggcattgggcgaaacaggggcagaatatgatgcccatctgatt
cggatcggtgatggtgatcagttctcgagcggttttgtggcggttaatccgaattcaaaa
attccggcactgatggaccattcaaccacgccgccggtcagggtgtttgaatctggtgcc
attttgctgtatttggcggataaatttggccatttcctgccccgctcggtggcaggacga
accgaagcgctcaattggctgttctggttacagggcgcggccccgtatttgggcggcggc
tttggtcatttttatcactatgcgccggtgaaaatcgaatatgccatcgaccgtttcgcc
atggaggccaagcgccagctctcgctgctcgataaccagctggccacccatgaatatatt
gccggtgatgaatattccatcgcggatatggctatctggccatggtacggcaatttggtg
ctgggcttgcaatatgaggcgggtgaattcttggatgtgaaatcctatacccacctgata
cggtggaccgaagccattgctaagcgcccggcagtacagcgcggccgtatcgtcaataaa
acctggggcgagccagcagaacagttagctgagcgccatgatgcagcggattttgaccgt
cttatcaagtaa

DBGET integrated database retrieval system