KEGG   Yersinia hibernica: D5F51_14045Help
Entry
D5F51_14045       CDS       T05961                                 

Definition
(GenBank) ATP-dependent dsDNA exonuclease
  KO
K03546  DNA repair protein SbcC/Rad50
Organism
yhi  Yersinia hibernica
Brite
KEGG Orthology (KO) [BR:yhi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:yhi03400]
    D5F51_14045
DNA repair and recombination proteins [BR:yhi03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     D5F51_14045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_23 SbcCD_C AAA_29 AAA_21 SMC_N ABC_tran NTPase_1 cobW MMR_HSR1 AAA_25 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: QAX79582
UniProt: A0A481QEJ9
LinkDB All DBs
Position
2954353..2958042
Genome map
AA seq 1229 aa AA seqDB search
MRILSLRLKNINSLQGEWKIDFTAEPFASSGLFAITGPTGAGKTTLLDAICLALYHQTPR
LNVTPSQNELMTRHTAESLAEVEFEVKGTRYRAFWSQRRAKNSPEGNLQAPKVELALCED
GKILADKVRDKLDMIAAITGLDFGRFTKSMLLSQGQFAAFLNADANDRAELLEELTGTDI
YGRLSEHVFEQHKQAKLALDTLHQRASGIELLNEEQRLALAQQLDALSEQEKQFTAEQHV
NQNQINWLTHWQQQQKNVLEYQQQQQLIEQEYQQAQPELQRLARSEPAEKLRPLLHERAR
SLQDLQQIQLRVTTLTAQQKQLQTQLTPLAHALEQANLARQQQAARQHEQETLIEQKVVP
LDNIIAQQQHALMLLATQLQQLRSKEQHVKQQVELNEQQLKQTHQRQQQLTEYTHQHAHH
QHWEKNLPLWREQFRQLHIQQKQLVESEQQLQQEVALLSSLQQQIATLNEQEKQQQTALA
QANAQAGSIQQQLSALEQQQPLAQLHQQLSELQQQRPVRQQLAALSPLAQQVQALHDKQQ
QQLAGQQQQRQQLEQQLAEKRQLYKQQKQHLTDLEALLESEKKIVKLEAERAKLQPGKAC
PLCGALDHPAIIEYQSVKPSETAMRVEELRLQVEQLFTVGTELRTQVANAQQQQLRLEQE
LQYSQQQLTDYQQQWQTLTQPLALTFALNEPTALAAWLQQQEQSEQICQQRRTEYEQLNQ
QYQQAKDILAQVEQQQQKHQQQLTFVIQRQQDAQQSHQKLLLQQQHQQAEWVKTRQDFSH
TLAELSLSLPETDQQQNWLSLREEENQHWQQYQQELQQLALAQKALETQIENERRHLQEC
IDQLSALSQQHQQAETLFQQQQQQRQALFGDIQVTEARQLLRQQQQQAELTQQNASHALQ
QAQSQLNLLSGELAALLQQKQQSQLRAAAAQTELQHALADSEFKDEDALTSALLNEEERQ
RLQQLKQQLSERLQQAHIRQQQASDALAQLILSCPAGVSQTSELAILQQRSEQLLAQLKA
NTLRQGELRNQLESDTVRRGNQHTLFEQIERSQQQYDDWSYLNHLIGSKEGDKFRKFAQG
LTLDHLVYLANNQLSRLHGRYQLQRKTSDALELQVVDTWQADAIRDTRTLSGGESFLVSL
ALALALSDLVSHKTSIDSLFLDEGFGTLDAETLDTALDALDSLNASGKTIGVISHVEAMK
DRIPVQIKVKKVNGLGVSRLDNIFRVNQD
NT seq 3690 nt NT seq  +upstreamnt  +downstreamnt
atgagaattttaagtttacggctgaaaaatattaattctctacaaggtgaatggaagatt
gatttcactgcagagccctttgccagcagcggattattcgctatcaccggcccgacaggg
gcgggtaaaaccacgctgcttgatgccatttgtctcgcgctataccaccaaactccgcgt
ttgaatgtcactcctagccaaaacgaactgatgactcgccacactgcggagtcgctagct
gaagttgaattcgaggtaaaaggaacacgttatcgcgcgttctggagccagcgccgtgcc
aaaaatagcccggagggaaatctacaagcccctaaagttgagctggcgctgtgtgaagat
ggcaaaatcctggcggataaagtgcgtgataagcttgatatgattgctgcgatcaccgga
ctggattttggccgattcaccaaatcgatgctgctatctcaggggcaattcgccgcgttc
cttaatgccgatgctaatgaccgcgcggaattattggaagaattaaccggcaccgatatc
tatgggcggttatctgaacatgtttttgaacagcataagcaggccaagctcgcgctagat
acattgcaccaacgtgccagtggtattgagcttcttaatgaagaacagcgtttagcttta
gcacaacaattagatgcactcagtgaacaagaaaaacagttcaccgcagagcaacacgtg
aatcaaaaccaaataaattggctcacccattggcaacagcagcaaaaaaatgtactcgaa
tatcaacaacaacagcagctcattgagcaagaatatcaacaagcacagcccgaactgcaa
cgactggcccgcagtgaacccgctgaaaagttacgccccttattgcatgagcgcgcacgt
agcctacaggatttgcagcagatacaactgcgtgttaccacactgacagcacaacaaaag
caacttcagacacaacttacaccactagcccacgcactggaacaggccaatcttgctcgc
caacagcaagcagctaggcagcatgaacaagaaacactgatcgagcaaaaagtcgttcca
ctggataacattattgctcaacagcagcacgcattaatgctacttgccacacaactacag
cagttacgcagtaaagaacagcatgttaaacaacaagttgaattaaatgagcaacagtta
aagcaaacccaccagcgccagcagcaactgacggagtatacccaccagcatgctcatcat
cagcactgggaaaaaaatctacccttgtggcgagagcaatttcgccaattacatattcag
caaaaacaattggttgaaagcgagcagcaattacagcaagaagtcgcattgctcagctcc
ttacaacagcaaatcgccacactaaatgaacaagaaaaacaacagcaaaccgcattagcc
caagccaatgctcaggcgggcagcattcagcaacaattgtcagcacttgaacagcaacaa
cctttagcacaattacaccaacagctgtctgaactccagcaacagcggccagtgcgacag
caattagccgcgttatcaccgctggcacaacaagtacaagcgctgcatgacaaacaacag
caacaattagcaggtcaacaacagcagcgacaacaactcgaacagcagttggcagaaaaa
cgtcagttatataaacaacaaaaacaacatctgacggatctggaagctttactggagagc
gaaaaaaaaatagtcaagttagaggcagagagagccaaactgcaaccggggaaggcatgc
ccattatgtggggcattggatcaccccgctattattgagtatcaatctgtcaaaccctca
gaaacggccatgcgagttgaagaactgcgacttcaggttgagcagcttttcactgtagga
acagaattacgcactcaggtagcaaatgcacaacagcagcagttacgcctagagcaagag
ctacagtacagccagcagcaattgactgattatcaacaacaatggcaaacactgacacaa
ccactggcgctgacatttgccttgaatgaacctacggctttagccgcctggctacagcaa
caggaacaatcagagcaaatctgccaacagagacggactgaatatgaacagctgaatcag
caatatcaacaagctaaagatattctggctcaggtagaacagcagcagcagaagcatcaa
cagcaattaacattcgtgattcagcgccaacaagatgcccagcaatctcaccagaaactg
cttttacaacagcaacatcaacaagctgagtgggtaaaaacgcgccaagattttagtcat
accctggcagaactatcactatcgctacctgaaacagaccaacaacagaactggctatct
ctgcgagaagaagaaaatcaacactggcagcagtaccaacaagagctgcagcagttggct
ctagcccaaaaagcgctggaaacgcagattgaaaatgagcgtcgccatttacaagaatgc
attgaccagctctcggcgctcagccaacagcatcaacaagccgaaaccttgttccagcaa
caacagcaacaacgccaggcactgtttggtgatattcaggtgacagaggcacgccagtta
ttacgccaacagcagcaacaggccgagttgacacagcagaatgcatctcacgcgctgcaa
caggcacaatctcaacttaacttgctatccggtgagttagcggcgctgctacagcaaaaa
cagcaaagtcagctgcgcgcggctgcagcccaaactgaattacaacacgcattggcagac
agtgaatttaaggatgaggatgccttaaccagcgcattactcaatgaagaagaaaggcaa
cgtttgcagcaattaaagcaacaattgagcgaacggctgcaacaagcacacatccgccag
cagcaagccagtgacgcgctagcacaacttatactctcttgccccgcaggggtcagccaa
acctccgaattggcaatattacaacagcggtcagagcagttactggcccaactgaaagcc
aatacattacggcaaggcgaattacgcaatcagttagaaagcgacacggttcgccgtggc
aaccaacatacgttatttgagcaaattgaacgtagtcagcaacaatatgatgactggagc
tacctcaatcatttaatcggttccaaagaaggcgataaattccgcaagtttgcacaaggt
ctgacactcgatcatttagtctatctggcaaataaccaactcagtcggctgcatggccgc
taccaactgcagcgtaaaaccagcgatgcgctggagctgcaagtggtggacacctggcaa
gcagacgctatccgtgatacccgcacactgtcagggggagaaagcttcttagtcagttta
gccctagccttggcgctatcagatttggtcagccataaaaccagtattgactcgctattc
cttgatgaaggctttggcaccttggatgcagagacgctggatactgcactggatgccctt
gatagcctgaatgcctcaggtaaaaccattggggttatcagccatgtcgaagcaatgaaa
gaccgaattccagtgcaaattaaagttaagaaagtcaatggattgggggttagccgctta
gataatatcttccgagtcaatcaagactga

DBGET integrated database retrieval system