KEGG   Yersinia hibernica: D5F51_19860Help
Entry
D5F51_19860       CDS       T05961                                 

Definition
(GenBank) stringent starvation protein A
  KO
K03599  stringent starvation protein A
Organism
yhi  Yersinia hibernica
Brite
KEGG Orthology (KO) [BR:yhi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:yhi03021]
    D5F51_19860
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:yhi02000]
    D5F51_19860
Transcription machinery [BR:yhi03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    RNA polymerase-associated proteins
     D5F51_19860
Transporters [BR:yhi02000]
 Other transporters
  Pores ion channels [TC:1]
   D5F51_19860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 Glutaredoxin GST_C_5
Motif
Other DBs
NCBI-ProteinID: QAX80578
UniProt: A0A481QIA4
LinkDB All DBs
Position
complement(4207796..4208437)
Genome map
AA seq 213 aa AA seqDB search
MAVAANKRSVMTLFSGPTDIFSHQVRIVLAEKGVSVEIEQVEADNLPQDLIDLNPYRTVP
TLVDRELTLYESRIIMEYLDERFPHPPLMPVYPVARGSSRLMMHRIEHDWYSLLHKIEQG
NAQEAEAARKQLREELLSIAPVFNEAPYFMSEEFSLVDCYLAPLLWRLPVLGIEFTGAGS
KELKGYMTRVFERDAFLASLTEAEREMRLQTRG
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcgctgccaacaaacgttcggtaatgacgctgttttccggcccgaccgacatt
tttagccatcaagtacgcatcgtactggcggagaaaggtgtcagtgttgagattgagcag
gttgaagctgataatctgccgcaggacttgattgacctcaacccttaccgtaccgttcct
actttggttgatcgcgagctaacgctgtatgaatcccgcatcatcatggaatacttggat
gagcgttttcctcatccaccattgatgccggtataccctgttgcacgtggtagcagccgt
ttgatgatgcaccgcattgagcatgactggtattccctgctgcacaaaatcgaacaaggc
aatgcccaagaagcggaagcagcacgtaaacaattgcgtgaagaactgctctccatcgct
ccggtgtttaatgaagcgccttactttatgagtgaagagttcagcctggtcgattgctat
ctggccccgctgttgtggcgcttgccagtattaggcattgaattcactggcgcgggttct
aaagagctgaaaggctatatgacacgtgtgtttgagcgtgatgcattcctggcttctctg
actgaagctgaacgtgaaatgcgcctgcaaacccggggttaa

DBGET integrated database retrieval system