KEGG   Yersinia hibernica: D5F51_20330
Entry
D5F51_20330       CDS       T05961                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
yhi  Yersinia hibernica
Pathway
yhi00480  Glutathione metabolism
yhi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yhi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    D5F51_20330
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:yhi02000]
    D5F51_20330
Enzymes [BR:yhi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     D5F51_20330
Transporters [BR:yhi02000]
 Other transporters
  Pores ion channels [TC:1]
   D5F51_20330
SSDB
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C GST_C_2 GST_N_4
Other DBs
NCBI-ProteinID: QAX80666
UniProt: A0A481QI47
LinkDB
Position
complement(4304007..4304675)
AA seq 222 aa
MVIVHHLNNSRSQRILWMLEELQVPYELQRYQRDPGSLLAPPELKKIHPLGKSPVITDGD
LTLAESGAIIEYLQETYDAQGLFKPTGHYDRQQFRYWMHYAEGSLMPLLVMKLIFSRFGG
PPVPWIIRPVAKALGDGVQKSYLNKQIATHRDYLEQHLSKNQWFAGSDFSAADIQMSFPI
EAINTRGSLEGFPKLQDFLVRIHQRPAYQQAIAKGGAFKLEK
NT seq 669 nt   +upstreamnt  +downstreamnt
atggtcattgttcaccatctgaataattcgcgttcacagcgtatcttgtggatgctggaa
gagttgcaagtcccctatgagttgcagcgctatcagcgcgatcccggcagcttgctggca
ccacccgagttgaaaaaaatccatccattggggaaatcaccggtgattactgatggtgac
ctgaccctggcggagtcgggcgctatcatcgaatacttgcaggaaacctatgatgcacaa
ggcttgtttaagcccaccggccattatgatcgccagcaatttcgttactggatgcattac
gctgaaggttcattgatgccacttttggtcatgaaacttatctttagccgcttcggtggg
ccgccagttccgtggattatccgcccagtagccaaggcattaggcgatggagtacagaaa
agctatctgaataagcaaattgccacccatcgtgattatcttgaacaacacttatcgaaa
aatcaatggtttgcaggcagtgattttagtgccgcagatattcagatgagttttcctatt
gaggcgataaatacacgcggtagccttgagggattcccaaaactgcaagatttcttagtg
cgaattcatcaacgcccagcttatcaacaggcgattgcaaagggcggcgctttcaaatta
gaaaagtga

DBGET integrated database retrieval system