KEGG   Yersinia intermedia: CH53_1683Help
Entry
CH53_1683         CDS       T03608                                 

Gene name
sodA
Definition
(GenBank) superoxide dismutase Mn
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
yin  Yersinia intermedia
Brite
Enzymes [BR:yin01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CH53_1683 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N HTH_54
Motif
Other DBs
NCBI-ProteinID: AJJ18014
UniProt: A9U910
LinkDB All DBs
Position
1908841..1909461
Genome map
AA seq 206 aa AA seqDB search
MSYSLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANTVLESFPELAKLSVEELIKD
LDKVPAEKRTFMRNNAGGHANHSLFWKGLKLDTTLTGDLKAAIERDFGSVDSFKEKFEAA
AATRFGSGWAWLVLKDGKLAVVSTANQDSPLMGEAVSGASGFPIIGLDVWEHAYYLKFQN
RRPDYIKAFWNVVNWDEAAARFAQAK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgagttactcactgccatccctgccttatgcttatgacgccctggaaccccatttcgat
aagcagacgatggaaatccatcacaccaaacaccaccagacctatgttaacaatgcaaac
acggtgttggagagcttccctgagctggctaaactgagcgttgaagagctgatcaaagat
ctggacaaagtccctgctgaaaaacgcacctttatgcgtaacaacgccggcggccacgct
aaccacagcctgttctggaaagggttgaagctggacactaccctgacgggtgacctgaaa
gccgctatcgagcgcgatttcggcagcgtagatagcttcaaagagaaatttgaagcagct
gcggcgacccgtttcggttctggctgggcctggctggttctgaaagacggcaaactggca
gttgtttctactgctaaccaagatagcccactgatgggtgaagcggtttctggcgcatca
ggcttcccaattattggcctggatgtgtgggaacacgcttactatctgaaattccaaaac
cgccgcccagactacatcaaagcattctggaacgtggttaactgggacgaagcagcagca
cgtttcgctcaagccaaataa

DBGET integrated database retrieval system