KEGG   Yersinia intermedia: CH53_1910Help
Entry
CH53_1910         CDS       T03608                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase family protein
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
yin  Yersinia intermedia
Pathway
yin00620  Pyruvate metabolism
yin00680  Methane metabolism
yin01100  Metabolic pathways
yin01120  Microbial metabolism in diverse environments
yin01200  Carbon metabolism
Module
yin_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:yin00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CH53_1910
  09102 Energy metabolism
   00680 Methane metabolism
    CH53_1910
Enzymes [BR:yin01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CH53_1910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AJJ17273
UniProt: A0A0T9MPN8
LinkDB All DBs
Position
complement(2161132..2163768)
Genome map
AA seq 878 aa AA seqDB search
MNEQYSAMRSNVSMLGTLLGDTIKEALGEHILEKVETIRKLSKSSRAGNEASRQELLTTL
QNLSNDELLPVARAFSQFLNLTNTAEQYHSISPHGEAASNPEALAQLFTRLKDKKLSEKD
MRSAVDELSIELVLTAHPTEITRRTLIHKLVEVNTCLSQLDHNDLADYERNKIMRRLRQL
VAQSWHTDEIRKIRPSPVDEAKWGFAVVENSLWEGVPAFLREFNEQLQNSLDYRLPVEAV
PIRFTSWMGGDRDGNPNVTAEITRHVLLLSRWKATDLFLRDIQVLVSELSMSECTPELRE
LAGGEEVVEPYRELMKRVRTQLTNTQAYLEGRLKGERVLPPTDLLVSNDQLWDPLYACYQ
SLKACGMEIIANGQLLDTLRRVRCFGVPLVRIDVRQESTRHTNAIAELTRYLGLGDYESW
SEADKQAFLVRELNSKRPLVPLKWEPSADTQEVLETCRVIAEAPQGSIAAYVISMAKVPS
DVLAVHLLLKEAGCPFTLPVAPLFETLDDLNNADEVMTQLLNIDWYRGLIQGKQMVMIGY
SDSAKDAGVMAASWAQYRAQDALIKTCEKAGISLTLFHGRGGSIGRGGAPAHAALLSQPP
GSLKGGLRVTEQGEMIRFKFGLPEVTISSLALYAGAILEANLLPPPEPKEEWIEVMDLLS
DASCDMYRGYVRENPEFVPYFRAATPELELGKLPLGSRPAKRRADGGVESLRAIPWIFAW
TQNRLMLPAWLGAGAGLQKAIDAGKKEALATMCRDWPFFSTRIGMLEMVFAKADLWLAEY
YDQRLVDKSLWPLGQQLRDQLAADIKVVLAIANDDHLMADLPWIAESIALRNVYTDPLNV
LQAELLHRSRQHEHPDARVEQALMVTIAGVAAGMRNTG
NT seq 2637 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattccgcaatgcgaagtaacgtcagtatgctcggtacgctactcggg
gacaccatcaaagaagcgcttggtgaacacatccttgaaaaagtagaaaccatccgtaaa
ttatccaaatcttcgcgtgctggtaatgaagcaagccgtcaggaactgctgaccacgctg
caaaatctgtccaacgacgagctgctgccagtagcccgtgcttttagccaattcctcaat
ctgacgaatacggcagagcaatatcacagtatttcaccacacggtgaagccgcaagtaac
ccagaagcgctggctcagcttttcacgcgcttaaaagataaaaagctgagcgagaaagat
atgcgcagcgcggttgatgagttatccattgagttggtgttaaccgctcatccaaccgaa
atcacccgccgcaccctgatccataaactggtggaagtgaatacctgcctgagccagttg
gatcacaatgacttagccgattacgaacgcaacaagatcatgcgtcgtttgcgccagtta
gtcgcacaatcatggcatactgacgaaattcgtaaaatacgcccttccccagtcgatgaa
gccaaatggggctttgccgtggttgaaaacagcctgtgggaaggtgtgcccgcatttctg
cgtgagtttaacgagcagttacaaaactcgctcgattaccgcttgccagtagaagccgtg
ccaatccgctttacctcttggatgggcggtgaccgtgacggtaacccgaacgtgaccgcc
gaaattacccgccatgtgctgttactcagccgttggaaagccaccgacctgttcctgcgc
gatattcaggtgctggtgtcagagctttcgatgtcggaatgcaccccggaactgcgtgaa
ctggccggtggcgaagaggtggtcgaaccttaccgcgaattaatgaaacgcgtccgtacc
cagttgaccaatactcaggcttatctggaaggccgtttgaaaggtgagcgtgtcttgccg
ccgactgatttgctggtcagtaatgaccaactgtgggatccgctttacgcctgttatcag
tctctgaaagcctgtggtatggagatcattgctaacggccaactgctggataccctgcgc
cgtgtgcgctgcttcggtgtgccattggtgcgtatcgatgtgcgccaggaaagcacccgc
cacaccaatgcgattgctgaactgactcgttatctgggccttggcgattatgaaagctgg
tctgaggcggacaaacaagccttcctggtgcgcgaactgaactccaagcgcccactggtt
ccgctaaaatgggaaccgagcgctgatacacaagaagtgctggaaacgtgccgggtgatt
gctgaagcaccacaaggctccatcgccgcttacgttatctccatggctaaagtgccatca
gacgtgctggcagtgcatttgctgctgaaagaagcgggttgcccattcactctgcccgtt
gcgccattgttcgaaacccttgatgacctgaacaatgccgatgaagtaatgacccagttg
ctaaatatcgactggtatcgcggcctgattcaaggcaagcaaatggtaatgattggctat
tccgactcagcaaaagatgctggcgtgatggctgcatcctgggcgcaatatcgggcgcaa
gatgcgttgatcaaaacctgcgagaaagccggtatctccctgaccttgttccacggtcgt
ggcggttctatcggacgtggcggtgcccctgcacatgcagccctgctctctcagcctccg
ggtagcttaaaaggtggcttgcgcgtcacggaacaaggcgagatgatccgctttaaattc
ggtctgccggaagtcactattagcagcctggcactctatgctggtgcgattctggaagct
aatttactgccaccaccggaaccgaaggaagagtggattgaggtgatggatctgctgtcg
gacgcatcctgtgatatgtatcgcggctatgtgcgtgaaaaccctgagtttgtcccttac
ttccgcgcggctacgccagagctggaattaggcaaattgccattgggttcacgcccagcc
aaacgccgcgcggacggcggagtggagagtctgcgcgccattccgtggattttcgcctgg
acacaaaaccgcctgatgctaccagcctggctgggtgcgggtgccggtttgcaaaaagcg
atcgatgccgggaagaaagaagcattagccacgatgtgtcgtgactggccattcttctct
acccgtatcgggatgctggaaatggtgttcgccaaagctgatttgtggctggcagagtat
tacgaccaacgtttggtggataaatcactgtggccattgggtcagcaattacgcgaccag
ctagcagcggatattaaagtggtgctggctatcgccaacgatgatcacttaatggctgat
ttgccgtggattgcagagtcaatcgcattgcgtaatgtgtataccgacccactgaacgtg
ctgcaagctgagctgttgcaccgttcgcgccagcatgagcacccagatgcccgtgttgag
caggcgttgatggtgacgattgccggtgttgctgcggggatgcgcaatacaggttag

DBGET integrated database retrieval system