KEGG   Yersinia intermedia: CH53_2165Help
Entry
CH53_2165         CDS       T03608                                 

Definition
(GenBank) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
yin  Yersinia intermedia
Pathway
yin00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:yin00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CH53_2165
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:yin02000]
    CH53_2165
Enzymes [BR:yin01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CH53_2165
Transporters [BR:yin02000]
 Other Transporters
  Pores ion channels [TC:1]
   CH53_2165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C GST_N_4 GST_C_2
Motif
Other DBs
NCBI-ProteinID: AJJ20092
UniProt: A0A0T9ME91
LinkDB All DBs
Position
2450247..2450915
Genome map
AA seq 222 aa AA seqDB search
MVTVHHLNNSRSQRILWMLEELQVPYELKRYQRDPGSLLAPPELKKIHPLGKSPVITDGD
LTLAESGAIIEYLQETYDAQGLFKPTGHYDRQQFRYWMHYAEGSLMPLLVMKLIFSRLGG
PPVPWIIRPVAKALGDGVQKSYLNKQIATHRDYLEQHLTNNQWFAGSDFSAADIQMSFPI
EAINTRGGLEGFPKLQDFLVRIHQRPAYQQAIEKGGAYKLES
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggtcacggttcaccatctgaataattcacgttcacagcgtattttgtggatgttggag
gaactgcaagttccctatgaattgaagcgctatcagcgcgatccgggcagccttctggca
ccgccagagttaaaaaagatccatccattaggaaaatcaccggtgattactgacggtgat
ctcactttggcagaatcgggtgccattattgagtatttacaggaaacctatgatgcccaa
gggttatttaaacccaccggtcactatgatcgtcagcagttccgttactggatgcattat
gcagaaggttcattgatgccattgctggtgatgaaacttatctttagccgattgggtggg
ccgcctgtaccgtggattattcgcccagttgccaaagcactgggtgatggcgtgcaaaaa
agttatctgaataagcaaatagcgactcaccgcgattatctggaacagcatttgacgaat
aatcagtggtttgctggcagtgatttcagcgcggcagatattcagatgagttttcctatc
gaggcaatcaacacccgtggtggtcttgaggggttcccgaaactgcaagatttcttagtg
cgcattcatcagcgcccagcttaccaacaagcgattgagaaggggggtgcctacaaactg
gaaagctga

DBGET integrated database retrieval system