KEGG   Yersinia intermedia: CH53_2553
Entry
CH53_2553         CDS       T03608                                 

Definition
(GenBank) type VI secretion system peptidoglycan-associated domain protein
  KO
K11892  type VI secretion system protein ImpK
Organism
yin  Yersinia intermedia
Pathway
yin03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:yin00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    CH53_2553
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:yin02044]
    CH53_2553
Secretion system [BR:yin02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   CH53_2553
SSDB
Motif
Pfam: DotU OmpA
Other DBs
NCBI-ProteinID: AJJ18434
UniProt: A0A0T9N3Y0
LinkDB
Position
2875124..2876485
AA seq 453 aa
MSPFDQSRDADTNPQALGHFLLDDQGTYTGSHDSTDNTEQSTDFNHKAAGSHSFQHYDTA
QLRGESVQQRVAKAVASSTPLLEAAQPLLRALSEMPETIADVSQVQILKDGLKNELTLFS
VVCDEADISWKKMAIIRYCLCTALDEAAHTMSWGVMSGWSQSNLLNHFEGDNDGGNKFFL
LVGRLSMSPHEYADCLEILLRILGLGFEGRYSIIEDGDRQLTKIRQGLLTLLQSTRDTVP
SAISPHGLVSQKFRKRRGIFIPVRVSMLLCGFLIASTFIASKYFLSVPESDLLKRMTALQ
RPIITQPPVAVQKLRLAVLLKDEIAKQLVSVDEKTSQSKVIFKGDTMFQVGSDKVRPEII
SVIERVAQEVHRVEGAVLIVGHTDSMPINKPGFPNNQVLSEKRAANVAHFMEKAGIPTDK
IRFEGKGDIQPVGSNDDATGRSQNRRVEIFVNY
NT seq 1362 nt   +upstreamnt  +downstreamnt
atgtccccctttgatcaaagcagagatgcggacactaatccgcaggcattgggccacttc
ttacttgatgatcaaggtacctatacgggtagccacgacagtacagataacactgaacaa
agcaccgatttcaatcacaaagctgccggttctcatagcttccagcattatgatacagcc
cagcttcgaggtgagagtgtacagcaacgagtagcaaaagccgtggcatcctctacaccg
ttattggaagccgcgcagccgctattacgtgccttgagtgaaatgccagaaacgatagca
gatgtttcgcaggttcagattttaaaagatgggctaaaaaatgagctcaccttgtttagc
gttgtctgtgatgaagcggatatctcatggaaaaaaatggcaattatccgctattgcttg
tgtactgcattagatgaagcggctcataccatgtcgtggggggtgatgtctggttggtcg
caaagtaacttattgaaccattttgaaggcgataacgacggcggcaataagtttttcctg
ttagtggggcgtctttcaatgagcccacacgaatatgcagattgtttagagatattgttg
cgaattttagggctaggttttgaaggtcgttacagcattattgaagatggtgatcggcag
ttaaccaaaattcgtcaggggttattaacgctgctgcaaagtaccagagatacggtaccg
tcggcaatttcgcctcatggcttggtctcgcagaaatttcgaaaacgtcgtgggattttt
attccggttcgtgtatcgatgttgctatgtggcttcttaattgcttccacttttattgcg
agcaaatattttctctccgtacctgaaagtgacttattgaagagaatgacagcattgcag
cgcccgattattacacaaccgccggttgctgtgcagaaattacgcctggcagttttatta
aaagatgaaattgccaagcaattagtcagtgttgatgaaaaaaccagccaaagcaaagtt
attttcaaaggcgatacgatgttccaggttggctcggataaggtcaggccggaaattatt
agtgtcattgaacgtgttgcccaggaagtacatcgtgtagaaggtgctgttctgattgtg
gggcacaccgactcaatgccaatcaataagcctggcttccccaataaccaggtgctttct
gaaaagcgtgctgccaatgttgcgcattttatggagaaagccggtatcccaacggacaaa
attcggtttgaggggaaaggggatatacagcctgttggtagtaatgatgatgcaactggg
cgctcacaaaaccgccgtgtagaaatatttgttaattattga

DBGET integrated database retrieval system