KEGG   Yersinia intermedia: CH53_4077Help
Entry
CH53_4077         CDS       T03608                                 

Gene name
gstB
Definition
(GenBank) glutathione S-transferase GST-6.0
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
yin  Yersinia intermedia
Pathway
yin00480  Glutathione metabolism
yin01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yin00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CH53_4077 (gstB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:yin02000]
    CH53_4077 (gstB)
Enzymes [BR:yin01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CH53_4077 (gstB)
Transporters [BR:yin02000]
 Other transporters
  Pores ion channels [TC:1]
   CH53_4077 (gstB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N GST_C_3 GST_N_2 GST_N_3 GST_C_2 GST_C_6
Motif
Other DBs
NCBI-ProteinID: AJJ20033
LinkDB All DBs
Position
4532052..4532660
Genome map
AA seq 202 aa AA seqDB search
MKLFYKPGACSLSPHIVLREAGLDFSIESVDLATKITETGEDYLSINPKGQVPALVLDDG
SLLTEGVAIVQYLADLVPDRHLIAPAGTLSRYHAIEWLNFVATELHKGFSPLFNPKTPDE
YKVIARERLDKQFSYVDSVLAQHDYLLGKKFSVADAYLFTVTRWANALKLDITQRSNLDK
YMARVAERPAVKAALAAEDVKK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgttctataaacccggtgcctgctctctgtctccacatatcgtattacgtgaa
gcggggttagacttcagtattgaaagtgtcgatctggcgaccaagataactgagacgggt
gaagactatttaagcatcaatccaaaaggacaggtccccgcgttggtactggatgatggc
agcctgctcactgagggtgttgctatcgtgcaatatctggctgatcttgtgcctgatcgc
cacctgattgccccggcaggaaccctttcccgctatcatgccattgaatggttaaacttc
gttgcgactgaattgcataagggcttcagcccactgtttaacccaaaaacaccagatgaa
tataaagtgatcgcccgtgagcggttggataaacaattcagttatgtagacagcgtatta
gcacaacatgattatctattaggtaagaaattcagcgtagctgatgcctatttatttact
gtcactcgctgggctaatgccctgaaacttgatattacgcagcgcagtaatttggataaa
tatatggcacgcgtggctgaacggccagccgttaaagccgcgttagcagcagaagacgtt
aagaaataa

DBGET integrated database retrieval system