KEGG   Yersinia intermedia: CH53_948Help
Entry
CH53_948          CDS       T03608                                 

Gene name
sodC
Definition
(GenBank) superoxide dismutase Cu-Zn
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
yin  Yersinia intermedia
Brite
Enzymes [BR:yin01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CH53_948 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AJJ17773
UniProt: A0A0T9LKC4
LinkDB All DBs
Position
complement(1067578..1068102)
Genome map
AA seq 174 aa AA seqDB search
MKLKYLTLPAMLFTSSVLAAGVTVTMNEALPEGNGKALGTVTVTETPYGLLFTPHLTGLV
AGIHGFHLHENPSCAPGQKDGKPVPALAAGGHFDPQKTAVHLGPYNDKGHLGDLPGLVVN
ADGSATYQVLAPRLKSLSELKQHALMIHAGGDNYADHPMPLGGGGARMACGVIE
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgaaatatttaacgttgccagcgatgctttttaccagcagtgtgctggctgcg
ggcgttacggtgaccatgaacgaagcactccctgaaggtaatggcaaggctctgggcacg
gtgacagtaactgaaacgccttatggtttactgttcacgcctcatttgaccgggttggtg
gcggggatacatgggtttcatctgcatgaaaacccaagttgtgctccagggcagaaagac
ggtaaacccgtgccagcacttgctgccggcggccattttgatccacaaaaaacggctgta
caccttgggccttataatgataaagggcatctgggggatttgccggggctggttgtgaat
gctgatggcagcgcgacttatcaggtattagctccacgcctgaaatcactctctgaactg
aaacagcatgccttgatgattcatgccggtggtgataactatgccgatcatccaatgccg
ctaggcggtggcggtgcgcgcatggcttgtggcgtgattgagtaa

DBGET integrated database retrieval system